Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   L897_RS09780 Genome accession   NC_021807
Coordinates   385197..385415 (+) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus pyogenes HSC5     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 380197..390415
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L897_RS01990 (L897_02065) - 381205..381780 (+) 576 WP_009880369.1 uracil-DNA glycosylase family protein -
  L897_RS01995 (L897_02070) ybeY 381939..382436 (+) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  L897_RS02000 (L897_02075) - 382417..382824 (+) 408 WP_002985746.1 diacylglycerol kinase family protein -
  L897_RS02005 (L897_02080) era 382944..383840 (+) 897 WP_020833313.1 GTPase Era -
  L897_RS02010 (L897_02085) - 383860..384336 (+) 477 WP_042361479.1 NUDIX hydrolase -
  L897_RS09775 (L897_02090) - 384642..384896 (-) 255 WP_014407373.1 hypothetical protein -
  L897_RS09780 comE/blpR 385197..385415 (+) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  L897_RS09785 - 385612..387218 (-) 1607 Protein_354 ABC transporter transmembrane domain-containing protein -
  L897_RS02030 (L897_02110) - 387516..387740 (+) 225 WP_020833315.1 Blp family class II bacteriocin -
  L897_RS09645 (L897_02115) - 387718..387894 (+) 177 WP_002994581.1 hypothetical protein -
  L897_RS10005 - 388189..388500 (+) 312 WP_225793061.1 CPBP family intramembrane glutamic endopeptidase -
  L897_RS09880 - 388585..388713 (+) 129 WP_002994583.1 hypothetical protein -
  L897_RS02040 (L897_02125) - 389111..389338 (+) 228 WP_028797129.1 Blp family class II bacteriocin -
  L897_RS02045 (L897_02130) - 389387..389704 (+) 318 WP_002994587.1 hypothetical protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=49728 L897_RS09780 WP_072135532.1 385197..385415(+) (comE/blpR) [Streptococcus pyogenes HSC5]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=49728 L897_RS09780 WP_072135532.1 385197..385415(+) (comE/blpR) [Streptococcus pyogenes HSC5]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417

Multiple sequence alignment