Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   IL989_RS11585 Genome accession   NZ_CP062984
Coordinates   2383792..2384106 (-) Length   104 a.a.
NCBI ID   WP_193350431.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain PP19 isolate PP19     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2378792..2389106
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IL989_RS11540 (IL989_11540) sinI 2379473..2379646 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  IL989_RS11545 (IL989_11545) sinR 2379680..2380015 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  IL989_RS11550 (IL989_11550) tasA 2380063..2380848 (-) 786 WP_193350428.1 biofilm matrix protein TasA -
  IL989_RS11555 (IL989_11555) sipW 2380913..2381497 (-) 585 WP_071348018.1 signal peptidase I SipW -
  IL989_RS11560 (IL989_11560) tapA 2381469..2382140 (-) 672 WP_193350429.1 amyloid fiber anchoring/assembly protein TapA -
  IL989_RS11565 (IL989_11565) - 2382398..2382727 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  IL989_RS11570 (IL989_11570) - 2382768..2382947 (-) 180 WP_016938971.1 YqzE family protein -
  IL989_RS11575 (IL989_11575) comGG 2383004..2383381 (-) 378 WP_193350430.1 competence type IV pilus minor pilin ComGG Machinery gene
  IL989_RS11580 (IL989_11580) comGF 2383383..2383883 (-) 501 WP_227014200.1 competence type IV pilus minor pilin ComGF -
  IL989_RS11585 (IL989_11585) comGE 2383792..2384106 (-) 315 WP_193350431.1 competence type IV pilus minor pilin ComGE Machinery gene
  IL989_RS11590 (IL989_11590) comGD 2384090..2384527 (-) 438 WP_065522768.1 competence type IV pilus minor pilin ComGD Machinery gene
  IL989_RS11595 (IL989_11595) comGC 2384517..2384825 (-) 309 WP_081301877.1 competence type IV pilus major pilin ComGC Machinery gene
  IL989_RS11600 (IL989_11600) comGB 2384830..2385867 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  IL989_RS11605 (IL989_11605) comGA 2385854..2386924 (-) 1071 WP_193350432.1 competence type IV pilus ATPase ComGA Machinery gene
  IL989_RS11610 (IL989_11610) - 2387118..2388068 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11925.98 Da        Isoelectric Point: 7.1305

>NTDB_id=492255 IL989_RS11585 WP_193350431.1 2383792..2384106(-) (comGE) [Bacillus amyloliquefaciens strain PP19 isolate PP19]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEERQEVYQLLHKHISAYMMSGKKQPSPGVMWKEDGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=492255 IL989_RS11585 WP_193350431.1 2383792..2384106(-) (comGE) [Bacillus amyloliquefaciens strain PP19 isolate PP19]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGATTTCTAT
CGTCCCGGTCTGGACGGGCATGCTGACAGATAATCTGAAAATAGAAGAACGCCAGGAAGTGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCGTCTCCCGGTGTGATGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCGGCTGTACGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481