Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IL989_RS11540 Genome accession   NZ_CP062984
Coordinates   2379473..2379646 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain PP19 isolate PP19     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2374473..2384646
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IL989_RS11525 (IL989_11525) gcvT 2375280..2376380 (-) 1101 WP_193351926.1 glycine cleavage system aminomethyltransferase GcvT -
  IL989_RS11530 (IL989_11530) - 2376808..2378478 (+) 1671 WP_193350427.1 DEAD/DEAH box helicase -
  IL989_RS11535 (IL989_11535) - 2378499..2379293 (+) 795 WP_065981875.1 YqhG family protein -
  IL989_RS11540 (IL989_11540) sinI 2379473..2379646 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  IL989_RS11545 (IL989_11545) sinR 2379680..2380015 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  IL989_RS11550 (IL989_11550) tasA 2380063..2380848 (-) 786 WP_193350428.1 biofilm matrix protein TasA -
  IL989_RS11555 (IL989_11555) sipW 2380913..2381497 (-) 585 WP_071348018.1 signal peptidase I SipW -
  IL989_RS11560 (IL989_11560) tapA 2381469..2382140 (-) 672 WP_193350429.1 amyloid fiber anchoring/assembly protein TapA -
  IL989_RS11565 (IL989_11565) - 2382398..2382727 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  IL989_RS11570 (IL989_11570) - 2382768..2382947 (-) 180 WP_016938971.1 YqzE family protein -
  IL989_RS11575 (IL989_11575) comGG 2383004..2383381 (-) 378 WP_193350430.1 competence type IV pilus minor pilin ComGG Machinery gene
  IL989_RS11580 (IL989_11580) comGF 2383383..2383883 (-) 501 WP_227014200.1 competence type IV pilus minor pilin ComGF -
  IL989_RS11585 (IL989_11585) comGE 2383792..2384106 (-) 315 WP_193350431.1 competence type IV pilus minor pilin ComGE Machinery gene
  IL989_RS11590 (IL989_11590) comGD 2384090..2384527 (-) 438 WP_065522768.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=492252 IL989_RS11540 WP_013352860.1 2379473..2379646(+) (sinI) [Bacillus amyloliquefaciens strain PP19 isolate PP19]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=492252 IL989_RS11540 WP_013352860.1 2379473..2379646(+) (sinI) [Bacillus amyloliquefaciens strain PP19 isolate PP19]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684