Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   BAMOH1_RS11645 Genome accession   NZ_CP061853
Coordinates   2451475..2451789 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus amyloliquefaciens strain MOH1-5b     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2446475..2456789
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMOH1_RS11600 (BAMOH1_11600) sinI 2447156..2447329 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  BAMOH1_RS11605 (BAMOH1_11605) sinR 2447363..2447698 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAMOH1_RS11610 (BAMOH1_11610) tasA 2447746..2448531 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAMOH1_RS11615 (BAMOH1_11615) sipW 2448596..2449180 (-) 585 WP_012117977.1 signal peptidase I SipW -
  BAMOH1_RS11620 (BAMOH1_11620) tapA 2449152..2449823 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  BAMOH1_RS11625 (BAMOH1_11625) - 2450082..2450411 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BAMOH1_RS11630 (BAMOH1_11630) - 2450452..2450631 (-) 180 WP_003153093.1 YqzE family protein -
  BAMOH1_RS11635 (BAMOH1_11635) comGG 2450688..2451065 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAMOH1_RS11640 (BAMOH1_11640) comGF 2451066..2451461 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  BAMOH1_RS11645 (BAMOH1_11645) comGE 2451475..2451789 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAMOH1_RS11650 (BAMOH1_11650) comGD 2451773..2452210 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAMOH1_RS11655 (BAMOH1_11655) comGC 2452200..2452466 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  BAMOH1_RS11660 (BAMOH1_11660) comGB 2452513..2453550 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAMOH1_RS11665 (BAMOH1_11665) comGA 2453537..2454607 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  BAMOH1_RS11670 (BAMOH1_11670) - 2454800..2455750 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=485290 BAMOH1_RS11645 WP_017418140.1 2451475..2451789(-) (comGE) [Bacillus amyloliquefaciens strain MOH1-5b]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=485290 BAMOH1_RS11645 WP_017418140.1 2451475..2451789(-) (comGE) [Bacillus amyloliquefaciens strain MOH1-5b]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481