NTDB

Overview

Name	comGD	Type	Machinery gene
Locus tag	BAMOH1_RS11650	Genome accession	NZ_CP061853
Coordinates	2451773..2452210 (-)	Length	145 a.a.
NCBI ID	WP_095061019.1	Uniprot ID	A0AAP4DGY0
Organism	Bacillus amyloliquefaciens strain MOH1-5b
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2446773..2457210

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BAMOH1_RS11600 (BAMOH1_11600)	sinI	2447156..2447329 (+)	174	WP_014418369.1	anti-repressor SinI	Regulator
BAMOH1_RS11605 (BAMOH1_11605)	sinR	2447363..2447698 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
BAMOH1_RS11610 (BAMOH1_11610)	tasA	2447746..2448531 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
BAMOH1_RS11615 (BAMOH1_11615)	sipW	2448596..2449180 (-)	585	WP_012117977.1	signal peptidase I SipW	-
BAMOH1_RS11620 (BAMOH1_11620)	tapA	2449152..2449823 (-)	672	WP_014418371.1	amyloid fiber anchoring/assembly protein TapA	-
BAMOH1_RS11625 (BAMOH1_11625)	-	2450082..2450411 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
BAMOH1_RS11630 (BAMOH1_11630)	-	2450452..2450631 (-)	180	WP_003153093.1	YqzE family protein	-
BAMOH1_RS11635 (BAMOH1_11635)	comGG	2450688..2451065 (-)	378	WP_017418138.1	competence type IV pilus minor pilin ComGG	Machinery gene
BAMOH1_RS11640 (BAMOH1_11640)	comGF	2451066..2451461 (-)	396	WP_025649850.1	competence type IV pilus minor pilin ComGF	-
BAMOH1_RS11645 (BAMOH1_11645)	comGE	2451475..2451789 (-)	315	WP_017418140.1	competence type IV pilus minor pilin ComGE	Machinery gene
BAMOH1_RS11650 (BAMOH1_11650)	comGD	2451773..2452210 (-)	438	WP_095061019.1	competence type IV pilus minor pilin ComGD	Machinery gene
BAMOH1_RS11655 (BAMOH1_11655)	comGC	2452200..2452466 (-)	267	WP_050496152.1	competence type IV pilus major pilin ComGC	Machinery gene
BAMOH1_RS11660 (BAMOH1_11660)	comGB	2452513..2453550 (-)	1038	WP_014418377.1	competence type IV pilus assembly protein ComGB	Machinery gene
BAMOH1_RS11665 (BAMOH1_11665)	comGA	2453537..2454607 (-)	1071	WP_014418378.1	competence type IV pilus ATPase ComGA	Machinery gene
BAMOH1_RS11670 (BAMOH1_11670)	-	2454800..2455750 (-)	951	WP_014418379.1	magnesium transporter CorA family protein	-
BAMOH1_RS11675 (BAMOH1_11675)	-	2455896..2457197 (+)	1302	WP_021494315.1	hemolysin family protein	-

Sequence

Protein

Download Length: 145 a.a. Molecular weight: 16282.81 Da Isoelectric Point: 10.1850

                                >NTDB_id=485291 BAMOH1_RS11650 WP_095061019.1 2451773..2452210(-) (comGD) [Bacillus amyloliquefaciens strain MOH1-5b]

MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLVVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK

LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

Download Length: 438 bp

                                >NTDB_id=485291 BAMOH1_RS11650 WP_095061019.1 2451773..2452210(-) (comGD) [Bacillus amyloliquefaciens strain MOH1-5b]

TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT

GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGTCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA

TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA

CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA

ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGTGCCGGGTTCACCTATGAGATCACAGTTT

ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(5-31)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGD	Bacillus subtilis subsp. subtilis str. 168	54.795	100	0.552

Detailed information NTG0485291