Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BAMOH1_RS11600 | Genome accession | NZ_CP061853 |
| Coordinates | 2447156..2447329 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus amyloliquefaciens strain MOH1-5b | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2442156..2452329
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAMOH1_RS11585 (BAMOH1_11585) | gcvT | 2442969..2444069 (-) | 1101 | WP_021494308.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BAMOH1_RS11590 (BAMOH1_11590) | - | 2444493..2446163 (+) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| BAMOH1_RS11595 (BAMOH1_11595) | - | 2446185..2446979 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| BAMOH1_RS11600 (BAMOH1_11600) | sinI | 2447156..2447329 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| BAMOH1_RS11605 (BAMOH1_11605) | sinR | 2447363..2447698 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BAMOH1_RS11610 (BAMOH1_11610) | tasA | 2447746..2448531 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| BAMOH1_RS11615 (BAMOH1_11615) | sipW | 2448596..2449180 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| BAMOH1_RS11620 (BAMOH1_11620) | tapA | 2449152..2449823 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BAMOH1_RS11625 (BAMOH1_11625) | - | 2450082..2450411 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| BAMOH1_RS11630 (BAMOH1_11630) | - | 2450452..2450631 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BAMOH1_RS11635 (BAMOH1_11635) | comGG | 2450688..2451065 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BAMOH1_RS11640 (BAMOH1_11640) | comGF | 2451066..2451461 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| BAMOH1_RS11645 (BAMOH1_11645) | comGE | 2451475..2451789 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BAMOH1_RS11650 (BAMOH1_11650) | comGD | 2451773..2452210 (-) | 438 | WP_095061019.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=485287 BAMOH1_RS11600 WP_014418369.1 2447156..2447329(+) (sinI) [Bacillus amyloliquefaciens strain MOH1-5b]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=485287 BAMOH1_RS11600 WP_014418369.1 2447156..2447329(+) (sinI) [Bacillus amyloliquefaciens strain MOH1-5b]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |