Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BAMOH1_RS11600 Genome accession   NZ_CP061853
Coordinates   2447156..2447329 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus amyloliquefaciens strain MOH1-5b     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2442156..2452329
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMOH1_RS11585 (BAMOH1_11585) gcvT 2442969..2444069 (-) 1101 WP_021494308.1 glycine cleavage system aminomethyltransferase GcvT -
  BAMOH1_RS11590 (BAMOH1_11590) - 2444493..2446163 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  BAMOH1_RS11595 (BAMOH1_11595) - 2446185..2446979 (+) 795 WP_014418368.1 YqhG family protein -
  BAMOH1_RS11600 (BAMOH1_11600) sinI 2447156..2447329 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  BAMOH1_RS11605 (BAMOH1_11605) sinR 2447363..2447698 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAMOH1_RS11610 (BAMOH1_11610) tasA 2447746..2448531 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAMOH1_RS11615 (BAMOH1_11615) sipW 2448596..2449180 (-) 585 WP_012117977.1 signal peptidase I SipW -
  BAMOH1_RS11620 (BAMOH1_11620) tapA 2449152..2449823 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  BAMOH1_RS11625 (BAMOH1_11625) - 2450082..2450411 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BAMOH1_RS11630 (BAMOH1_11630) - 2450452..2450631 (-) 180 WP_003153093.1 YqzE family protein -
  BAMOH1_RS11635 (BAMOH1_11635) comGG 2450688..2451065 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAMOH1_RS11640 (BAMOH1_11640) comGF 2451066..2451461 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  BAMOH1_RS11645 (BAMOH1_11645) comGE 2451475..2451789 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAMOH1_RS11650 (BAMOH1_11650) comGD 2451773..2452210 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=485287 BAMOH1_RS11600 WP_014418369.1 2447156..2447329(+) (sinI) [Bacillus amyloliquefaciens strain MOH1-5b]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=485287 BAMOH1_RS11600 WP_014418369.1 2447156..2447329(+) (sinI) [Bacillus amyloliquefaciens strain MOH1-5b]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719