NTDB

Overview

Name	comGD	Type	Machinery gene
Locus tag	BAINH2_RS11625	Genome accession	NZ_CP061852
Coordinates	2459136..2459573 (-)	Length	145 a.a.
NCBI ID	WP_012117983.1	Uniprot ID	-
Organism	Bacillus amyloliquefaciens strain INH2-4b
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2454136..2464573

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BAINH2_RS11575 (BAINH2_11575)	sinI	2454520..2454693 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
BAINH2_RS11580 (BAINH2_11580)	sinR	2454727..2455062 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
BAINH2_RS11585 (BAINH2_11585)	tasA	2455110..2455895 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
BAINH2_RS11590 (BAINH2_11590)	sipW	2455960..2456544 (-)	585	WP_015240205.1	signal peptidase I SipW	-
BAINH2_RS11595 (BAINH2_11595)	tapA	2456516..2457187 (-)	672	WP_053573199.1	amyloid fiber anchoring/assembly protein TapA	-
BAINH2_RS11600 (BAINH2_11600)	-	2457446..2457775 (+)	330	WP_039254490.1	DUF3889 domain-containing protein	-
BAINH2_RS11605 (BAINH2_11605)	-	2457815..2457994 (-)	180	WP_003153093.1	YqzE family protein	-
BAINH2_RS11610 (BAINH2_11610)	comGG	2458051..2458428 (-)	378	WP_015417814.1	competence type IV pilus minor pilin ComGG	Machinery gene
BAINH2_RS11615 (BAINH2_11615)	comGF	2458429..2458929 (-)	501	WP_256052909.1	competence type IV pilus minor pilin ComGF	-
BAINH2_RS11620 (BAINH2_11620)	comGE	2458838..2459152 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
BAINH2_RS11625 (BAINH2_11625)	comGD	2459136..2459573 (-)	438	WP_012117983.1	competence type IV pilus minor pilin ComGD	Machinery gene
BAINH2_RS11630 (BAINH2_11630)	comGC	2459563..2459871 (-)	309	WP_079979070.1	competence type IV pilus major pilin ComGC	Machinery gene
BAINH2_RS11635 (BAINH2_11635)	comGB	2459876..2460913 (-)	1038	WP_053573197.1	competence type IV pilus assembly protein ComGB	Machinery gene
BAINH2_RS11640 (BAINH2_11640)	comGA	2460900..2461970 (-)	1071	WP_053573196.1	competence type IV pilus ATPase ComGA	Machinery gene
BAINH2_RS11645 (BAINH2_11645)	-	2462163..2463113 (-)	951	WP_015417820.1	magnesium transporter CorA family protein	-
BAINH2_RS11650 (BAINH2_11650)	-	2463259..2464560 (+)	1302	WP_012117986.1	hemolysin family protein	-

Sequence

Protein

Download Length: 145 a.a. Molecular weight: 16286.74 Da Isoelectric Point: 10.2475

                                >NTDB_id=485213 BAINH2_RS11625 WP_012117983.1 2459136..2459573(-) (comGD) [Bacillus amyloliquefaciens strain INH2-4b]

MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK

LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

Download Length: 438 bp

                                >NTDB_id=485213 BAINH2_RS11625 WP_012117983.1 2459136..2459573(-) (comGD) [Bacillus amyloliquefaciens strain INH2-4b]

TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT

GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA

TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA

CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA

ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT

ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(5-31)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.849	100	0.572

Detailed information NTG0485213