Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   SPN034183_RS02690 Genome accession   NC_021028
Coordinates   496038..496187 (+) Length   49 a.a.
NCBI ID   WP_001808912.1    Uniprot ID   -
Organism   Streptococcus pneumoniae SPN034183     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 491038..501187
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPN034183_RS02665 (SPN034183_04910) blpC 491349..491504 (-) 156 WP_000358813.1 quorum-sensing system pheromone BlpC -
  SPN034183_RS02670 (SPN034183_04920) - 491561..492922 (-) 1362 WP_015545695.1 bacteriocin secretion accessory protein -
  SPN034183_RS13405 comA/nlmT 492933..493436 (-) 504 WP_001808910.1 ATP-binding cassette domain-containing protein Regulator
  SPN034183_RS13410 comA/nlmT 493405..493845 (-) 441 WP_001808911.1 ATP-binding cassette domain-containing protein Regulator
  SPN034183_RS13415 comA/nlmT 493835..494560 (-) 726 WP_167750760.1 ABC transporter transmembrane domain-containing protein Regulator
  SPN034183_RS13420 (SPN034183_04940) comA/nlmT 494505..495092 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  SPN034183_RS02685 (SPN034183_04950) blpI 495374..495571 (+) 198 WP_001093258.1 bacteriocin-like peptide BlpI -
  SPN034183_RS02690 cipB 496038..496187 (+) 150 WP_001808912.1 bacteriocin-like peptide BlpO Regulator
  SPN034183_RS02695 (SPN034183_04990) - 496291..496410 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  SPN034183_RS02705 (SPN034183_05020) - 497196..497579 (+) 384 WP_000877381.1 hypothetical protein -
  SPN034183_RS02710 (SPN034183_05030) - 497631..498320 (+) 690 WP_000760526.1 CPBP family intramembrane glutamic endopeptidase -
  SPN034183_RS02715 (SPN034183_05040) blpZ 498362..498610 (+) 249 WP_000276499.1 immunity protein BlpZ -
  SPN034183_RS02720 (SPN034183_05050) - 498640..499251 (+) 612 WP_000394047.1 type II CAAX endopeptidase family protein -
  SPN034183_RS02725 (SPN034183_05060) - 499412..500206 (+) 795 WP_000363002.1 phosphotransferase family protein -
  SPN034183_RS02730 (SPN034183_05070) trmB 500203..500838 (+) 636 WP_001266080.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.86 Da        Isoelectric Point: 3.7098

>NTDB_id=48149 SPN034183_RS02690 WP_001808912.1 496038..496187(+) (cipB) [Streptococcus pneumoniae SPN034183]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=48149 SPN034183_RS02690 WP_001808912.1 496038..496187(+) (cipB) [Streptococcus pneumoniae SPN034183]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment