NTDB

Overview

Name	comYF	Type	Machinery gene
Locus tag	IB936_RS00630	Genome accession	NZ_CP061133
Coordinates	102354..102788 (+)	Length	144 a.a.
NCBI ID	WP_002992738.1	Uniprot ID	-
Organism	Streptococcus pyogenes strain BSAC_bs472 isolate Invasive disease
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 97354..107788

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IB936_RS00600 (IB936_00600)	-	99023..99388 (+)	366	WP_002986560.1	DUF1033 family protein	-
IB936_RS00605 (IB936_00605)	comYA	99481..100419 (+)	939	WP_002987773.1	competence type IV pilus ATPase ComGA	Machinery gene
IB936_RS00610 (IB936_00610)	comYB	100355..101389 (+)	1035	WP_011054115.1	competence type IV pilus assembly protein ComGB	Machinery gene
IB936_RS00615 (IB936_00615)	comYC	101391..101717 (+)	327	WP_011528161.1	competence type IV pilus major pilin ComGC	Machinery gene
IB936_RS00620 (IB936_00620)	comGD	101692..102120 (+)	429	WP_002986548.1	competence type IV pilus minor pilin ComGD	-
IB936_RS00625 (IB936_00625)	comGE	102077..102361 (+)	285	WP_011528162.1	competence type IV pilus minor pilin ComGE	-
IB936_RS00630 (IB936_00630)	comYF	102354..102788 (+)	435	WP_002992738.1	competence type IV pilus minor pilin ComGF	Machinery gene
IB936_RS00635 (IB936_00635)	comGG	102772..103098 (+)	327	WP_010921801.1	competence type IV pilus minor pilin ComGG	-
IB936_RS00640 (IB936_00640)	comYH	103196..104149 (+)	954	WP_021299429.1	class I SAM-dependent methyltransferase	Machinery gene
IB936_RS00645 (IB936_00645)	-	104208..105404 (+)	1197	WP_011528164.1	acetate kinase	-
IB936_RS00650 (IB936_00650)	-	105591..105899 (+)	309	WP_011528165.1	hypothetical protein	-
IB936_RS00655 (IB936_00655)	proC	105982..106752 (-)	771	WP_002986527.1	pyrroline-5-carboxylate reductase	-

Sequence

Protein

Download Length: 144 a.a. Molecular weight: 16645.27 Da Isoelectric Point: 10.2526

                                >NTDB_id=480906 IB936_RS00630 WP_002992738.1 102354..102788(+) (comYF) [Streptococcus pyogenes strain BSAC_bs472 isolate Invasive disease]

MSKQLSNIKAFTLLEALIALLVISGSLLVYQGLTQTLLKRSHYLARHDQDNWLLFSHQLREELSGARFYKVADNKLYVEK

GKKVLAFGQFKSHDFRKSASNGKGYQPMLFGISRSHIHIEQSQICITLKWKSGLERTFYYAFQD

Nucleotide

Download Length: 435 bp

                                >NTDB_id=480906 IB936_RS00630 WP_002992738.1 102354..102788(+) (comYF) [Streptococcus pyogenes strain BSAC_bs472 isolate Invasive disease]

TTGAGTAAACAATTAAGTAACATAAAAGCTTTTACCCTTCTAGAGGCGTTAATAGCCTTACTCGTGATATCAGGGTCTTT

ATTGGTTTATCAAGGTTTGACCCAAACCCTCCTTAAACGTAGCCATTATCTAGCCCGTCATGATCAAGACAATTGGCTCT

TATTTTCTCATCAATTGCGAGAGGAGTTAAGTGGAGCAAGATTTTACAAAGTAGCTGATAATAAACTATACGTTGAAAAG

GGAAAGAAAGTACTAGCTTTTGGCCAATTTAAAAGTCATGATTTTCGAAAATCAGCTAGTAATGGAAAAGGGTATCAACC

CATGTTATTTGGAATATCACGTAGTCATATTCACATAGAGCAGTCACAGATTTGCATTACTTTAAAGTGGAAAAGTGGGT

TAGAAAGGACTTTTTATTATGCCTTTCAAGACTAA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(41-135)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYF	Streptococcus mutans UA140	51.079	96.528	0.493
comYF	Streptococcus mutans UA159	50.36	96.528	0.486
comGF	Lactococcus lactis subsp. cremoris KW2	46.715	95.139	0.444
comGF/cglF	Streptococcus mitis NCTC 12261	44.776	93.056	0.417
comGF/cglF	Streptococcus pneumoniae Rx1	43.609	92.361	0.403
comGF/cglF	Streptococcus pneumoniae D39	43.609	92.361	0.403
comGF/cglF	Streptococcus pneumoniae R6	43.609	92.361	0.403
comGF/cglF	Streptococcus pneumoniae TIGR4	43.609	92.361	0.403
comGF/cglF	Streptococcus mitis SK321	42.857	92.361	0.396

Detailed information NTG0480906