Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | IBB96_RS09920 | Genome accession | NZ_CP061023 |
| Coordinates | 274667..274876 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain 13499 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 269667..279876
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IBB96_RS01480 (IBB96_01490) | - | 270105..270614 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| IBB96_RS01485 (IBB96_01495) | - | 270926..271483 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| IBB96_RS01490 (IBB96_01500) | - | 271486..272136 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| IBB96_RS01495 (IBB96_01505) | comR | 272331..273230 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| IBB96_RS09910 | - | 273468..273899 (+) | 432 | Protein_242 | cysteine peptidase family C39 domain-containing protein | - |
| IBB96_RS09915 | - | 273929..274645 (+) | 717 | Protein_243 | ABC transporter transmembrane domain-containing protein | - |
| IBB96_RS09920 | comA | 274667..274876 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| IBB96_RS01520 (IBB96_01530) | - | 274931..275499 (+) | 569 | Protein_245 | ATP-binding cassette domain-containing protein | - |
| IBB96_RS01525 (IBB96_01535) | - | 275607..275924 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| IBB96_RS09925 | - | 275887..276171 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| IBB96_RS09930 | - | 276411..277307 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| IBB96_RS01535 (IBB96_01545) | - | 277712..278227 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| IBB96_RS01540 (IBB96_01550) | - | 278252..278554 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| IBB96_RS01545 (IBB96_01555) | - | 278566..278877 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=479733 IBB96_RS09920 WP_002946147.1 274667..274876(+) (comA) [Streptococcus thermophilus strain 13499]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=479733 IBB96_RS09920 WP_002946147.1 274667..274876(+) (comA) [Streptococcus thermophilus strain 13499]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |