Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | IBC04_RS09910 | Genome accession | NZ_CP061020 |
| Coordinates | 268825..269034 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain 24740 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 263825..274034
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IBC04_RS01420 (IBC04_01425) | - | 264263..264772 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| IBC04_RS01425 (IBC04_01430) | - | 265084..265641 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| IBC04_RS01430 (IBC04_01435) | - | 265644..266294 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| IBC04_RS01435 (IBC04_01440) | comR | 266489..267388 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| IBC04_RS09900 | - | 267626..268057 (+) | 432 | Protein_243 | cysteine peptidase family C39 domain-containing protein | - |
| IBC04_RS09905 | - | 268087..268803 (+) | 717 | Protein_244 | ABC transporter transmembrane domain-containing protein | - |
| IBC04_RS09910 | comA | 268825..269034 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| IBC04_RS01460 (IBC04_01465) | - | 269089..269657 (+) | 569 | Protein_246 | ATP-binding cassette domain-containing protein | - |
| IBC04_RS01465 (IBC04_01470) | - | 269765..270082 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| IBC04_RS09915 | - | 270045..270329 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| IBC04_RS09920 | - | 270569..271465 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| IBC04_RS01475 (IBC04_01480) | - | 271870..272385 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| IBC04_RS01480 (IBC04_01485) | - | 272410..272712 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| IBC04_RS01485 (IBC04_01490) | - | 272724..273035 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=479561 IBC04_RS09910 WP_002946147.1 268825..269034(+) (comA) [Streptococcus thermophilus strain 24740]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=479561 IBC04_RS09910 WP_002946147.1 268825..269034(+) (comA) [Streptococcus thermophilus strain 24740]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |