Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPCU_RS07965 Genome accession   NC_017358
Coordinates   33608..33721 (+) Length   37 a.a.
NCBI ID   WP_001217864.1    Uniprot ID   A0A0E0W910
Organism   Helicobacter pylori Cuz20     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 28608..38721
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPCU_RS00165 (HPCU_00150) - 28650..30869 (+) 2220 WP_001051540.1 AAA family ATPase -
  HPCU_RS00170 (HPCU_00155) panD 30859..31209 (+) 351 WP_000142269.1 aspartate 1-decarboxylase -
  HPCU_RS00175 (HPCU_00160) - 31220..31522 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HPCU_RS00180 (HPCU_00165) - 31522..32529 (+) 1008 WP_000468455.1 PDZ domain-containing protein -
  HPCU_RS00185 (HPCU_00170) comB6 32537..33592 (+) 1056 WP_000786664.1 P-type conjugative transfer protein TrbL Machinery gene
  HPCU_RS07965 comB7 33608..33721 (+) 114 WP_001217864.1 hypothetical protein Machinery gene
  HPCU_RS00190 (HPCU_00175) comB8 33718..34461 (+) 744 WP_000660504.1 type IV secretion system protein Machinery gene
  HPCU_RS00195 (HPCU_00180) comB9 34461..35426 (+) 966 WP_014534167.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPCU_RS00200 (HPCU_00185) comB10 35419..36555 (+) 1137 WP_001045874.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPCU_RS00205 (HPCU_00190) - 36625..38037 (+) 1413 WP_000694823.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=46760 HPCU_RS07965 WP_001217864.1 33608..33721(+) (comB7) [Helicobacter pylori Cuz20]
MRIFFVIIGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=46760 HPCU_RS07965 WP_001217864.1 33608..33721(+) (comB7) [Helicobacter pylori Cuz20]
ATGAGAATTTTTTTTGTTATTATAGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACACTGTATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0E0W910

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892


Multiple sequence alignment