Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   H0X93_RS15580 Genome accession   NZ_CP059125
Coordinates   3232726..3233199 (+) Length   157 a.a.
NCBI ID   WP_024167014.1    Uniprot ID   -
Organism   Escherichia coli strain EC45     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3195117..3236602 3232726..3233199 within 0


Gene organization within MGE regions


Location: 3195117..3236602
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0X93_RS15290 (H0X93_15245) intS 3195117..3196274 (+) 1158 WP_060504054.1 prophage integrase IntS -
  H0X93_RS15295 (H0X93_15250) - 3196466..3196783 (+) 318 WP_040073225.1 hypothetical protein -
  H0X93_RS15300 (H0X93_15255) - 3196815..3198176 (-) 1362 WP_209428899.1 WzyE family oligosaccharide polymerase -
  H0X93_RS25145 - 3198179..3200362 (-) 2184 WP_257623325.1 phage head-binding domain-containing protein -
  H0X93_RS15310 (H0X93_15265) - 3200463..3201365 (-) 903 WP_032275665.1 phage antirepressor N-terminal domain-containing protein -
  H0X93_RS15315 (H0X93_15270) - 3201428..3201649 (-) 222 WP_021572780.1 hypothetical protein -
  H0X93_RS15320 (H0X93_15275) - 3201646..3201804 (-) 159 WP_001555391.1 Arc family DNA-binding protein -
  H0X93_RS15325 (H0X93_15280) - 3201895..3202149 (+) 255 WP_000090237.1 Arc family DNA-binding protein -
  H0X93_RS15330 (H0X93_15285) - 3202199..3202918 (+) 720 WP_000749484.1 hypothetical protein -
  H0X93_RS15335 (H0X93_15290) - 3202909..3203457 (+) 549 WP_001263856.1 PIN domain-containing protein -
  H0X93_RS15340 (H0X93_15295) - 3203585..3203812 (+) 228 WP_000832789.1 hypothetical protein -
  H0X93_RS15345 (H0X93_15300) - 3203809..3205932 (-) 2124 WP_021572779.1 hypothetical protein -
  H0X93_RS15350 (H0X93_15305) - 3205917..3207266 (-) 1350 WP_096837163.1 DNA transfer protein -
  H0X93_RS15355 (H0X93_15310) - 3207277..3207969 (-) 693 WP_021572776.1 hypothetical protein -
  H0X93_RS15360 (H0X93_15315) - 3207972..3208427 (-) 456 WP_021562335.1 DUF2824 family protein -
  H0X93_RS15365 (H0X93_15320) - 3208427..3209380 (-) 954 WP_060504040.1 tail needle knob protein -
  H0X93_RS15370 (H0X93_15325) - 3209380..3210798 (-) 1419 WP_060504038.1 packaged DNA stabilization protein gp10 -
  H0X93_RS15375 (H0X93_15330) - 3210858..3211289 (-) 432 WP_050484735.1 packaged DNA stabilization gp4 family protein -
  H0X93_RS15380 (H0X93_15335) - 3211264..3211449 (-) 186 WP_000375639.1 hypothetical protein -
  H0X93_RS15385 (H0X93_15340) - 3211492..3212763 (-) 1272 WP_122648569.1 P22 phage major capsid protein family protein -
  H0X93_RS15390 (H0X93_15345) - 3212775..3213659 (-) 885 WP_000426736.1 hypothetical protein -
  H0X93_RS15395 (H0X93_15350) - 3213673..3215799 (-) 2127 WP_060504033.1 portal protein -
  H0X93_RS15400 (H0X93_15355) - 3215802..3217214 (-) 1413 WP_060504031.1 PBSX family phage terminase large subunit -
  H0X93_RS15405 (H0X93_15360) - 3217211..3217636 (-) 426 WP_000179915.1 hypothetical protein -
  H0X93_RS15410 (H0X93_15365) - 3217716..3217958 (-) 243 WP_000807785.1 DUF2560 family protein -
  H0X93_RS15415 (H0X93_15370) - 3218186..3218791 (-) 606 WP_021528610.1 Rha family transcriptional regulator -
  H0X93_RS15420 (H0X93_15375) - 3218941..3219384 (-) 444 WP_126755858.1 lysis protein -
  H0X93_RS15425 (H0X93_15380) rrrD 3219381..3219878 (-) 498 WP_060504025.1 lysozyme RrrD -
  H0X93_RS15430 (H0X93_15385) - 3219878..3220093 (-) 216 WP_000839574.1 class II holin family protein -
  H0X93_RS15445 (H0X93_15400) - 3220641..3221264 (-) 624 WP_001235461.1 antitermination protein -
  H0X93_RS15450 (H0X93_15405) - 3221261..3221449 (-) 189 WP_000994513.1 protein ninH -
  H0X93_RS15455 (H0X93_15410) - 3221446..3221808 (-) 363 WP_001008200.1 RusA family crossover junction endodeoxyribonuclease -
  H0X93_RS15460 (H0X93_15415) - 3221805..3222095 (-) 291 WP_032181228.1 DUF1364 domain-containing protein -
  H0X93_RS15465 (H0X93_15420) - 3222095..3222817 (-) 723 WP_122648565.1 phage antirepressor KilAC domain-containing protein -
  H0X93_RS15470 (H0X93_15425) - 3222810..3222986 (-) 177 WP_000950943.1 protein NinF -
  H0X93_RS15475 (H0X93_15430) - 3222979..3223347 (-) 369 WP_047624827.1 phage protein NinX family protein -
  H0X93_RS15480 (H0X93_15435) - 3223350..3223526 (-) 177 WP_086711682.1 NinE family protein -
  H0X93_RS15485 (H0X93_15440) - 3223523..3223933 (-) 411 WP_060504015.1 recombination protein NinB -
  H0X93_RS15490 (H0X93_15445) - 3223942..3224148 (-) 207 WP_001515066.1 hypothetical protein -
  H0X93_RS15495 (H0X93_15450) - 3224151..3224417 (-) 267 WP_060504012.1 hypothetical protein -
  H0X93_RS15500 (H0X93_15455) - 3224429..3224629 (-) 201 WP_000049638.1 hypothetical protein -
  H0X93_RS15505 (H0X93_15460) - 3224626..3224952 (-) 327 WP_000796282.1 hypothetical protein -
  H0X93_RS15510 (H0X93_15465) - 3225028..3226464 (-) 1437 WP_001549089.1 DnaB-like helicase C-terminal domain-containing protein -
  H0X93_RS15515 (H0X93_15470) - 3226454..3227344 (-) 891 WP_000539336.1 hypothetical protein -
  H0X93_RS15520 (H0X93_15475) - 3227331..3227492 (-) 162 WP_000166961.1 hypothetical protein -
  H0X93_RS15525 (H0X93_15480) - 3227527..3227805 (-) 279 WP_001177653.1 lambda phage CII family protein -
  H0X93_RS15530 (H0X93_15485) - 3227914..3228099 (-) 186 WP_000276886.1 Cro/CI family transcriptional regulator -
  H0X93_RS15535 (H0X93_15490) - 3228180..3228830 (+) 651 WP_000856967.1 LexA family transcriptional regulator -
  H0X93_RS15540 (H0X93_15495) - 3229233..3229532 (+) 300 WP_060504010.1 hypothetical protein -
  H0X93_RS15545 (H0X93_15500) - 3229541..3230011 (+) 471 WP_000167595.1 hypothetical protein -
  H0X93_RS15550 (H0X93_15505) - 3230155..3230466 (+) 312 WP_122650017.1 superinfection exclusion protein -
  H0X93_RS15555 (H0X93_15510) - 3230502..3231470 (+) 969 WP_122650018.1 cell envelope biogenesis protein TolA -
  H0X93_RS15560 (H0X93_15515) - 3231495..3231626 (+) 132 WP_000638547.1 protease FtsH-inhibitory lysogeny factor CIII -
  H0X93_RS15565 (H0X93_15520) kil 3231611..3231763 (+) 153 WP_005106717.1 host cell division inhibitory peptide Kil -
  H0X93_RS15570 - 3231760..3231918 (+) 159 WP_000010966.1 hypothetical protein -
  H0X93_RS15575 (H0X93_15525) - 3232018..3232725 (+) 708 WP_060504008.1 Rad52/Rad22 family DNA repair protein -
  H0X93_RS15580 (H0X93_15530) ssb 3232726..3233199 (+) 474 WP_024167014.1 single-stranded DNA-binding protein Machinery gene
  H0X93_RS15585 (H0X93_15535) - 3233697..3234245 (+) 549 WP_001016186.1 3'-5' exonuclease -
  H0X93_RS15590 (H0X93_15540) - 3234262..3234558 (+) 297 WP_060504006.1 phage anti-RecBCD protein -
  H0X93_RS15595 (H0X93_15545) - 3234569..3234736 (+) 168 WP_060504005.1 DUF2737 family protein -
  H0X93_RS25445 - 3234733..3235002 (+) 270 Protein_3080 ead/Ea22-like family protein -
  H0X93_RS15605 (H0X93_15555) - 3235167..3235994 (+) 828 WP_106464552.1 DUF551 domain-containing protein -
  H0X93_RS15610 (H0X93_15560) - 3236091..3236270 (+) 180 WP_001277766.1 Eag protein -
  H0X93_RS15615 (H0X93_15565) torI 3236402..3236602 (+) 201 WP_001163428.1 response regulator inhibitor TorI -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17648.47 Da        Isoelectric Point: 7.4024

>NTDB_id=467234 H0X93_RS15580 WP_024167014.1 3232726..3233199(+) (ssb) [Escherichia coli strain EC45]
MASRGVNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKQTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYL
EGKLRTRKWQDQSGQDRFTTEVIVGVGGTMQMLGGKQGGNEQSSHQRNNGQQQRQQSQQQGNHSEPPMNFDDSDIPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=467234 H0X93_RS15580 WP_024167014.1 3232726..3233199(+) (ssb) [Escherichia coli strain EC45]
ATGGCAAGCAGAGGCGTAAATAAGGTGATCATTATTGGTCGCCTTGGGCATGATCCAGAAATCAGATATTCACCATCAGG
AACGGCATTTGCAAACCTTACAGTTGCTACGTCAGAACAATGGCGTGATAAGCAAACTGGAGAGCAAAAGGAGCAGACGG
AGTGGCACCGCGTGGTAATGAGCGGGAAACTGGCAGAAATTGCCAGCGAATATCTGCGAAAAGGCTCTGAGGTTTATCTT
GAAGGCAAATTGCGGACAAGAAAATGGCAGGATCAAAGTGGACAGGATCGGTTCACTACCGAAGTCATCGTGGGCGTTGG
TGGAACCATGCAAATGCTTGGTGGCAAACAAGGAGGCAATGAACAGTCTTCACATCAGCGAAATAACGGTCAGCAACAAA
GACAGCAATCTCAGCAGCAGGGGAATCACAGCGAACCACCTATGAACTTCGACGATTCGGATATTCCGTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

60.674

100

0.688
  ssb Glaesserella parasuis strain SC1401

50.549

100

0.586
  ssb Neisseria meningitidis MC58

41.243

100

0.465
  ssb Neisseria gonorrhoeae MS11

41.243

100

0.465
  ssbA Bacillus subtilis subsp. subtilis str. 168

32.203

100

0.363