Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   HZ322_RS10805 Genome accession   NZ_CP059049
Coordinates   2232919..2233203 (-) Length   94 a.a.
NCBI ID   WP_017865155.1    Uniprot ID   -
Organism   Lactococcus lactis strain N8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2227919..2238203
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HZ322_RS10770 (HZ322_10775) rpmG 2228198..2228347 (-) 150 WP_010906305.1 50S ribosomal protein L33 -
  HZ322_RS10775 (HZ322_10780) - 2228388..2229503 (-) 1116 Protein_2116 acyltransferase family protein -
  HZ322_RS10780 (HZ322_10785) - 2229514..2229807 (+) 294 WP_226898169.1 pseudouridine synthase -
  HZ322_RS10785 (HZ322_10790) - 2229846..2230655 (-) 810 WP_014570791.1 metal ABC transporter permease -
  HZ322_RS10790 (HZ322_10795) - 2230648..2231385 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  HZ322_RS10795 (HZ322_10800) - 2231562..2232404 (-) 843 WP_017865154.1 metal ABC transporter substrate-binding protein -
  HZ322_RS10800 (HZ322_10805) - 2232401..2232838 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  HZ322_RS10805 (HZ322_10810) comGG 2232919..2233203 (-) 285 WP_017865155.1 competence type IV pilus minor pilin ComGG Machinery gene
  HZ322_RS10810 (HZ322_10815) comGF 2233242..2233688 (-) 447 WP_032948129.1 competence type IV pilus minor pilin ComGF Machinery gene
  HZ322_RS10815 (HZ322_10820) comGE 2233651..2233947 (-) 297 WP_017865157.1 competence type IV pilus minor pilin ComGE Machinery gene
  HZ322_RS10820 (HZ322_10825) comGD 2233919..2234350 (-) 432 WP_026138965.1 competence type IV pilus minor pilin ComGD Machinery gene
  HZ322_RS10825 (HZ322_10830) comGC 2234310..2234645 (-) 336 WP_032948139.1 competence type IV pilus major pilin ComGC Machinery gene
  HZ322_RS10830 (HZ322_10835) comGB 2234707..2235780 (-) 1074 WP_080613278.1 competence type IV pilus assembly protein ComGB Machinery gene
  HZ322_RS10835 (HZ322_10840) comGA 2235674..2236612 (-) 939 WP_026138968.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10782.04 Da        Isoelectric Point: 5.5720

>NTDB_id=466826 HZ322_RS10805 WP_017865155.1 2232919..2233203(-) (comGG) [Lactococcus lactis strain N8]
MFSMFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=466826 HZ322_RS10805 WP_017865155.1 2232919..2233203(-) (comGG) [Lactococcus lactis strain N8]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

60.215

98.936

0.596