Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   H0A38_RS11105 Genome accession   NZ_CP059048
Coordinates   2254716..2255000 (-) Length   94 a.a.
NCBI ID   WP_017865155.1    Uniprot ID   -
Organism   Lactococcus lactis strain LAC460     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2249716..2260000
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0A38_RS11075 (H0A38_11015) - 2250158..2250535 (-) 378 WP_033900715.1 pyridoxamine 5'-phosphate oxidase family protein -
  H0A38_RS11080 (H0A38_11020) - 2250739..2251605 (+) 867 WP_058204413.1 RluA family pseudouridine synthase -
  H0A38_RS11085 (H0A38_11025) - 2251643..2252452 (-) 810 WP_014570791.1 metal ABC transporter permease -
  H0A38_RS11090 (H0A38_11030) - 2252445..2253182 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  H0A38_RS11095 (H0A38_11035) - 2253359..2254201 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  H0A38_RS11100 (H0A38_11040) - 2254198..2254635 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  H0A38_RS11105 (H0A38_11045) comGG 2254716..2255000 (-) 285 WP_017865155.1 competence type IV pilus minor pilin ComGG Machinery gene
  H0A38_RS11110 (H0A38_11050) comGF 2255039..2255485 (-) 447 WP_165379808.1 competence type IV pilus minor pilin ComGF Machinery gene
  H0A38_RS11115 (H0A38_11055) comGE 2255448..2255744 (-) 297 WP_033900709.1 competence type IV pilus minor pilin ComGE Machinery gene
  H0A38_RS11120 (H0A38_11060) comGD 2255716..2256147 (-) 432 WP_226319344.1 competence type IV pilus minor pilin ComGD Machinery gene
  H0A38_RS11125 (H0A38_11065) comGC 2256107..2256490 (-) 384 WP_012898622.1 competence type IV pilus major pilin ComGC Machinery gene
  H0A38_RS11130 (H0A38_11070) comGB 2256504..2257577 (-) 1074 WP_080735950.1 competence type IV pilus assembly protein ComGB Machinery gene
  H0A38_RS11135 (H0A38_11075) comGA 2257471..2258409 (-) 939 WP_033900707.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10782.04 Da        Isoelectric Point: 5.5720

>NTDB_id=466778 H0A38_RS11105 WP_017865155.1 2254716..2255000(-) (comGG) [Lactococcus lactis strain LAC460]
MFSMFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=466778 H0A38_RS11105 WP_017865155.1 2254716..2255000(-) (comGG) [Lactococcus lactis strain LAC460]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

60.215

98.936

0.596