Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   JQR77_RS07885 Genome accession   NZ_CP069275
Coordinates   1535431..1535670 (-) Length   79 a.a.
NCBI ID   WP_011681565.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain EG007     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1530431..1540670
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JQR77_RS07855 (JQR77_07860) - 1532155..1532535 (-) 381 WP_002951783.1 hypothetical protein -
  JQR77_RS07860 (JQR77_07865) - 1532660..1532923 (-) 264 WP_002945924.1 hypothetical protein -
  JQR77_RS07865 (JQR77_07870) - 1533245..1533541 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  JQR77_RS07870 (JQR77_07875) - 1533706..1534632 (-) 927 WP_022096485.1 thioredoxin family protein -
  JQR77_RS07875 (JQR77_07880) - 1534819..1534998 (-) 180 WP_011681564.1 hypothetical protein -
  JQR77_RS07880 (JQR77_07885) - 1535027..1535419 (-) 393 WP_003094909.1 hypothetical protein -
  JQR77_RS07885 (JQR77_07890) cipB 1535431..1535670 (-) 240 WP_011681565.1 Blp family class II bacteriocin Regulator
  JQR77_RS07890 (JQR77_07895) - 1535887..1537457 (+) 1571 WP_106693466.1 IS3-like element ISSth1b family transposase -
  JQR77_RS07895 (JQR77_07900) - 1537603..1537857 (-) 255 WP_014608660.1 Blp family class II bacteriocin -
  JQR77_RS09705 - 1538108..1538509 (-) 402 WP_011226490.1 hypothetical protein -
  JQR77_RS07900 (JQR77_07905) - 1539514..1539744 (-) 231 WP_011226494.1 bacteriocin class II family protein -
  JQR77_RS07905 (JQR77_07910) - 1540100..1540300 (-) 201 WP_011681569.1 hypothetical protein -
  JQR77_RS07910 (JQR77_07915) - 1540319..1540495 (-) 177 WP_011681570.1 Blp family class II bacteriocin -

Sequence


Protein


Download         Length: 79 a.a.        Molecular weight: 7727.69 Da        Isoelectric Point: 3.8735

>NTDB_id=464684 JQR77_RS07885 WP_011681565.1 1535431..1535670(-) (cipB) [Streptococcus thermophilus strain EG007]
MATQTIENFNTLDLETLASVEGGRVNWERWGMCGASVAVGASEGFSAAAGGTAFFIGPYAIGTGAVGAAIGGGVALLGC

Nucleotide


Download         Length: 240 bp        

>NTDB_id=464684 JQR77_RS07885 WP_011681565.1 1535431..1535670(-) (cipB) [Streptococcus thermophilus strain EG007]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAATGTGTGGGGCCTCTGTCGCCGTAGGTGCTTCAGAAGGATTCTCTGCAGCTGCAGGTGGAACGGCTT
TCTTCATTGGACCGTATGCAATTGGAACTGGTGCAGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.459

77.215

0.405