Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbB   Type   Machinery gene
Locus tag   HW576_RS26115 Genome accession   NZ_CP058262
Coordinates   5032092..5032454 (-) Length   120 a.a.
NCBI ID   WP_013059785.1    Uniprot ID   -
Organism   Priestia megaterium strain BIM B-1314D     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 5027580..5068385 5032092..5032454 within 0


Gene organization within MGE regions


Location: 5027580..5068385
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HW576_RS26105 (HW576_26105) - 5027580..5030210 (+) 2631 WP_064472198.1 DEAD/DEAH box helicase -
  HW576_RS26110 (HW576_26110) - 5030508..5031554 (+) 1047 WP_063670706.1 C40 family peptidase -
  HW576_RS26115 (HW576_26115) ssbB 5032092..5032454 (-) 363 WP_013059785.1 single-stranded DNA-binding protein Machinery gene
  HW576_RS26120 (HW576_26120) - 5032551..5032988 (+) 438 WP_014457773.1 YwpF-like family protein -
  HW576_RS26125 (HW576_26125) - 5033511..5033933 (+) 423 WP_013059787.1 helix-turn-helix transcriptional regulator -
  HW576_RS26130 (HW576_26130) fabZ 5033962..5034396 (-) 435 WP_013059788.1 3-hydroxyacyl-ACP dehydratase FabZ -
  HW576_RS26135 (HW576_26135) - 5034480..5035301 (-) 822 WP_098277600.1 flagellar hook-basal body protein -
  HW576_RS26140 (HW576_26140) - 5035325..5036149 (-) 825 WP_029319385.1 flagellar hook-basal body protein -
  HW576_RS26145 (HW576_26145) - 5036264..5037265 (-) 1002 WP_013059791.1 rod shape-determining protein -
  HW576_RS26150 (HW576_26150) spoIIID 5037452..5037715 (-) 264 WP_013059792.1 sporulation transcriptional regulator SpoIIID -
  HW576_RS26155 (HW576_26155) - 5037991..5038821 (-) 831 WP_028409695.1 M23 family metallopeptidase -
  HW576_RS26160 (HW576_26160) spoIID 5038984..5040006 (-) 1023 WP_029319387.1 stage II sporulation protein D -
  HW576_RS26165 (HW576_26165) murA 5040169..5041473 (-) 1305 WP_013059795.1 UDP-N-acetylglucosamine 1-carboxyvinyltransferase -
  HW576_RS26170 (HW576_26170) - 5041505..5042245 (-) 741 WP_013059796.1 YwmB family TATA-box binding protein -
  HW576_RS26175 (HW576_26175) - 5042406..5042642 (-) 237 WP_013059797.1 DUF1146 family protein -
  HW576_RS26180 (HW576_26180) - 5042917..5043321 (-) 405 WP_013059798.1 F0F1 ATP synthase subunit epsilon -
  HW576_RS26185 (HW576_26185) atpD 5043348..5044769 (-) 1422 WP_013059799.1 F0F1 ATP synthase subunit beta -
  HW576_RS26190 (HW576_26190) - 5044806..5045663 (-) 858 WP_013059800.1 F0F1 ATP synthase subunit gamma -
  HW576_RS26195 (HW576_26195) atpA 5045769..5047277 (-) 1509 WP_013085461.1 F0F1 ATP synthase subunit alpha -
  HW576_RS26200 (HW576_26200) - 5047293..5047838 (-) 546 WP_177563928.1 F0F1 ATP synthase subunit delta -
  HW576_RS26205 (HW576_26205) - 5047835..5048353 (-) 519 WP_013085463.1 F0F1 ATP synthase subunit B -
  HW576_RS26210 (HW576_26210) atpE 5048456..5048668 (-) 213 WP_013059804.1 F0F1 ATP synthase subunit C -
  HW576_RS26215 (HW576_26215) atpB 5048759..5049469 (-) 711 WP_013059805.1 F0F1 ATP synthase subunit A -
  HW576_RS26220 (HW576_26220) - 5049488..5049859 (-) 372 WP_013059806.1 ATP synthase subunit I -
  HW576_RS26225 (HW576_26225) - 5049866..5050087 (-) 222 WP_013059807.1 AtpZ/AtpI family protein -
  HW576_RS26230 (HW576_26230) - 5050385..5052577 (-) 2193 WP_098277601.1 S8 family serine peptidase -
  HW576_RS26235 (HW576_26235) wecB 5052646..5053797 (-) 1152 WP_025601419.1 UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) -
  HW576_RS26240 (HW576_26240) upp 5053820..5054449 (-) 630 WP_013059810.1 uracil phosphoribosyltransferase -
  HW576_RS26245 (HW576_26245) glyA 5054663..5055907 (-) 1245 WP_013059811.1 serine hydroxymethyltransferase -
  HW576_RS26250 (HW576_26250) - 5056025..5056597 (-) 573 WP_029711154.1 TIGR01440 family protein -
  HW576_RS26255 (HW576_26255) rpiB 5056612..5057073 (-) 462 WP_025601414.1 ribose 5-phosphate isomerase B -
  HW576_RS26260 (HW576_26260) - 5057154..5057582 (-) 429 WP_025601411.1 low molecular weight protein arginine phosphatase -
  HW576_RS26265 (HW576_26265) - 5057633..5057788 (-) 156 WP_155660731.1 hypothetical protein -
  HW576_RS26270 (HW576_26270) - 5057811..5058371 (-) 561 WP_013059815.1 manganese efflux pump MntP family protein -
  HW576_RS26275 (HW576_26275) - 5058439..5059479 (-) 1041 WP_025601926.1 L-threonylcarbamoyladenylate synthase -
  HW576_RS26280 (HW576_26280) - 5059672..5060118 (-) 447 WP_029319403.1 acetyltransferase -
  HW576_RS26285 (HW576_26285) spoIIR 5060204..5061094 (-) 891 WP_055991595.1 stage II sporulation protein R -
  HW576_RS26290 (HW576_26290) prmC 5061215..5062066 (-) 852 WP_029319407.1 peptide chain release factor N(5)-glutamine methyltransferase -
  HW576_RS26295 (HW576_26295) prfA 5062066..5063133 (-) 1068 WP_013059820.1 peptide chain release factor 1 -
  HW576_RS26300 (HW576_26300) - 5063272..5063895 (-) 624 WP_029319409.1 thymidine kinase -
  HW576_RS26305 (HW576_26305) rpmE 5064091..5064291 (-) 201 WP_013059822.1 50S ribosomal protein L31 -
  HW576_RS26310 (HW576_26310) rho 5064446..5065720 (-) 1275 WP_013059823.1 transcription termination factor Rho -
  HW576_RS26315 (HW576_26315) - 5066247..5067533 (-) 1287 WP_013059824.1 UDP-N-acetylglucosamine 1-carboxyvinyltransferase -
  HW576_RS26320 (HW576_26320) fsa 5067741..5068385 (-) 645 WP_013059825.1 fructose-6-phosphate aldolase -

Sequence


Protein


Download         Length: 120 a.a.        Molecular weight: 13486.22 Da        Isoelectric Point: 7.1647

>NTDB_id=463335 HW576_RS26115 WP_013059785.1 5032092..5032454(-) (ssbB) [Priestia megaterium strain BIM B-1314D]
MINHIILVGRLTKKPELRYTHEGIAVSTITLAINRTFRNVEGEYDADFVNITLWRKNAENTAAYCDKGAVVGVVGRVQTR
TFENNLQQRVYMTDVVADAVKFLSGKPSGFSSFDSNQQEE

Nucleotide


Download         Length: 363 bp        

>NTDB_id=463335 HW576_RS26115 WP_013059785.1 5032092..5032454(-) (ssbB) [Priestia megaterium strain BIM B-1314D]
ATGATTAACCATATTATTCTTGTAGGAAGACTGACAAAAAAACCTGAGCTTCGATATACCCATGAAGGGATTGCAGTATC
TACTATTACTTTAGCAATTAATCGAACGTTTCGAAATGTTGAAGGTGAATATGATGCTGATTTTGTCAACATTACTCTGT
GGAGAAAAAATGCAGAAAATACGGCTGCTTACTGTGATAAAGGAGCGGTTGTAGGTGTGGTAGGGCGTGTACAAACGCGC
ACATTTGAAAATAATCTTCAGCAACGAGTATATATGACCGACGTTGTGGCTGATGCTGTTAAGTTTTTAAGTGGAAAGCC
ATCCGGTTTTTCTTCATTTGATTCAAATCAACAAGAAGAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.813

89.167

0.533

  ssbA Bacillus subtilis subsp. subtilis str. 168

56.604

88.333

0.5

  ssb Latilactobacillus sakei subsp. sakei 23K

51.887

88.333

0.458

  ssbB/cilA Streptococcus mitis NCTC 12261

41.509

88.333

0.367

  ssbB/cilA Streptococcus pneumoniae TIGR4

41.509

88.333

0.367