Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HVY70_RS03840 Genome accession   NZ_CP057330
Coordinates   798049..798564 (+) Length   171 a.a.
NCBI ID   WP_181693904.1    Uniprot ID   -
Organism   Klebsiella oxytoca strain RHB30-C02     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 785605..848430 798049..798564 within 0


Gene organization within MGE regions


Location: 785605..848430
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HVY70_RS03770 (HVY70_03770) - 785718..786590 (+) 873 WP_181693892.1 ParA family protein -
  HVY70_RS03775 (HVY70_03775) - 786587..786943 (+) 357 WP_181693893.1 hypothetical protein -
  HVY70_RS03780 (HVY70_03780) - 786940..787182 (+) 243 WP_181693894.1 hypothetical protein -
  HVY70_RS03785 (HVY70_03785) dnaB-PI 787192..788562 (+) 1371 WP_181693895.1 SPI-7-type island replicative DNA helicase -
  HVY70_RS03790 (HVY70_03790) - 788559..790226 (+) 1668 WP_181693896.1 ParB family protein -
  HVY70_RS03795 (HVY70_03795) - 790219..790941 (+) 723 WP_181693993.1 DUF2786 domain-containing protein -
  HVY70_RS03800 (HVY70_03800) - 790938..791363 (+) 426 WP_181693897.1 hypothetical protein -
  HVY70_RS03805 (HVY70_03805) - 791360..791968 (+) 609 WP_181693898.1 DUF2857 domain-containing protein -
  HVY70_RS29840 - 791965..792213 (+) 249 WP_227636270.1 hypothetical protein -
  HVY70_RS03810 (HVY70_03810) - 792304..793542 (+) 1239 WP_181693899.1 STY4528 family pathogenicity island replication protein -
  HVY70_RS03815 (HVY70_03815) - 793502..793756 (-) 255 WP_181693900.1 hypothetical protein -
  HVY70_RS03820 (HVY70_03820) - 793828..794583 (+) 756 WP_181693901.1 TIGR03761 family integrating conjugative element protein -
  HVY70_RS03825 (HVY70_03825) - 794597..796642 (+) 2046 WP_181693902.1 DNA topoisomerase III -
  HVY70_RS03830 (HVY70_03830) - 797291..797755 (+) 465 WP_181693903.1 STY4534 family ICE replication protein -
  HVY70_RS03835 (HVY70_03835) - 797833..798036 (+) 204 WP_032191374.1 hypothetical protein -
  HVY70_RS03840 (HVY70_03840) ssb 798049..798564 (+) 516 WP_181693904.1 single-stranded DNA-binding protein Machinery gene
  HVY70_RS03845 (HVY70_03845) - 799092..799961 (+) 870 WP_181693905.1 hypothetical protein -
  HVY70_RS03850 (HVY70_03850) - 800524..801609 (-) 1086 WP_123828779.1 hypothetical protein -
  HVY70_RS03855 (HVY70_03855) - 801852..801941 (+) 90 WP_227636269.1 DUF2442 domain-containing protein -
  HVY70_RS03860 (HVY70_03860) - 802071..802667 (+) 597 WP_181693906.1 PilL N-terminal domain-containing protein -
  HVY70_RS03865 (HVY70_03865) - 802664..803386 (+) 723 WP_181693907.1 hypothetical protein -
  HVY70_RS03870 (HVY70_03870) - 803393..804097 (+) 705 WP_181693908.1 TIGR03759 family integrating conjugative element protein -
  HVY70_RS03875 (HVY70_03875) - 804076..804750 (+) 675 WP_181693909.1 transglycosylase SLT domain-containing protein -
  HVY70_RS03880 (HVY70_03880) - 804750..805262 (+) 513 WP_181693910.1 integrating conjugative element protein -
  HVY70_RS03885 (HVY70_03885) - 805262..805861 (+) 600 WP_016190705.1 restriction endonuclease -
  HVY70_RS03890 (HVY70_03890) - 805858..806370 (+) 513 WP_181693911.1 hypothetical protein -
  HVY70_RS03895 (HVY70_03895) traD 806363..808453 (+) 2091 WP_181693912.1 type IV conjugative transfer system coupling protein TraD -
  HVY70_RS03900 (HVY70_03900) - 808446..809204 (+) 759 WP_181693913.1 TIGR03747 family integrating conjugative element membrane protein -
  HVY70_RS03905 (HVY70_03905) - 809506..810498 (-) 993 WP_181693914.1 DUF4928 family protein -
  HVY70_RS03910 (HVY70_03910) dcm 810491..811630 (-) 1140 WP_181693915.1 DNA (cytosine-5-)-methyltransferase -
  HVY70_RS03915 (HVY70_03915) - 811968..812309 (+) 342 WP_181693916.1 RAQPRD family integrative conjugative element protein -
  HVY70_RS03920 (HVY70_03920) - 812309..812551 (+) 243 WP_016190712.1 TIGR03758 family integrating conjugative element protein -
  HVY70_RS03925 (HVY70_03925) - 812582..812968 (+) 387 WP_109240647.1 TIGR03745 family integrating conjugative element membrane protein -
  HVY70_RS03930 (HVY70_03930) - 812978..813334 (+) 357 WP_016190714.1 TIGR03750 family conjugal transfer protein -
  HVY70_RS03935 (HVY70_03935) - 813331..813990 (+) 660 WP_101862487.1 TIGR03746 family integrating conjugative element protein -
  HVY70_RS03940 (HVY70_03940) - 813990..814919 (+) 930 WP_181693917.1 TIGR03749 family integrating conjugative element protein -
  HVY70_RS03945 (HVY70_03945) - 814909..816414 (+) 1506 WP_181693918.1 TIGR03752 family integrating conjugative element protein -
  HVY70_RS03950 (HVY70_03950) - 816426..816839 (+) 414 WP_181693919.1 TIGR03751 family conjugal transfer lipoprotein -
  HVY70_RS03955 (HVY70_03955) - 816839..819703 (+) 2865 WP_181693920.1 conjugative transfer ATPase -
  HVY70_RS03960 (HVY70_03960) - 819700..820086 (+) 387 WP_181693921.1 acetyltransferase -
  HVY70_RS03965 (HVY70_03965) - 820234..820695 (-) 462 WP_181693922.1 DUF4231 domain-containing protein -
  HVY70_RS03970 (HVY70_03970) - 820711..821940 (-) 1230 WP_181693923.1 hypothetical protein -
  HVY70_RS03975 (HVY70_03975) - 821921..822424 (-) 504 WP_181693924.1 response regulator -
  HVY70_RS03980 (HVY70_03980) - 822434..825949 (-) 3516 WP_181693925.1 hypothetical protein -
  HVY70_RS03985 (HVY70_03985) - 826667..827068 (+) 402 WP_117075971.1 TIGR03757 family integrating conjugative element protein -
  HVY70_RS03990 (HVY70_03990) - 827065..828057 (+) 993 WP_181693926.1 TIGR03756 family integrating conjugative element protein -
  HVY70_RS03995 (HVY70_03995) - 828069..829502 (+) 1434 WP_181693927.1 integrating conjugative element protein -
  HVY70_RS04000 (HVY70_04000) - 829516..829869 (+) 354 WP_181693928.1 hypothetical protein -
  HVY70_RS04005 (HVY70_04005) - 829876..831417 (+) 1542 WP_097582736.1 conjugal transfer protein TraG N-terminal domain-containing protein -
  HVY70_RS04010 (HVY70_04010) - 831452..831631 (-) 180 WP_016190727.1 hypothetical protein -
  HVY70_RS04015 (HVY70_04015) - 831779..832336 (+) 558 WP_227636267.1 hypothetical protein -
  HVY70_RS04020 (HVY70_04020) - 832462..833163 (+) 702 WP_181693929.1 YkgJ family cysteine cluster protein -
  HVY70_RS04025 (HVY70_04025) - 834137..835039 (+) 903 WP_181693930.1 integrase domain-containing protein -
  HVY70_RS04030 (HVY70_04030) - 835036..835623 (+) 588 WP_181693931.1 hypothetical protein -
  HVY70_RS04035 (HVY70_04035) - 835984..836322 (+) 339 WP_016190731.1 hypothetical protein -
  HVY70_RS04040 (HVY70_04040) - 836460..837458 (+) 999 WP_181693932.1 hypothetical protein -
  HVY70_RS04045 (HVY70_04045) - 837566..838180 (+) 615 WP_181693933.1 hypothetical protein -
  HVY70_RS04050 (HVY70_04050) - 838253..839314 (+) 1062 WP_227636266.1 ArdC-like ssDNA-binding domain-containing protein -
  HVY70_RS04055 (HVY70_04055) - 839421..840356 (+) 936 WP_181693934.1 DUF1281 domain-containing protein -
  HVY70_RS04060 (HVY70_04060) - 840476..841159 (+) 684 WP_181693935.1 N-6 DNA methylase -
  HVY70_RS04065 (HVY70_04065) - 841338..843848 (-) 2511 WP_181693936.1 DEAD/DEAH box helicase -
  HVY70_RS04070 (HVY70_04070) - 844106..845590 (+) 1485 WP_181693937.1 UvrD-helicase domain-containing protein -
  HVY70_RS04075 (HVY70_04075) - 845584..847149 (+) 1566 WP_181693938.1 TraI domain-containing protein -
  HVY70_RS04080 (HVY70_04080) - 847210..848220 (+) 1011 WP_181693939.1 site-specific integrase -

Sequence


Protein


Download         Length: 171 a.a.        Molecular weight: 18872.88 Da        Isoelectric Point: 7.3174

>NTDB_id=461644 HVY70_RS03840 WP_181693904.1 798049..798564(+) (ssb) [Klebsiella oxytoca strain RHB30-C02]
MASRGINKVILVGNLGQDPEVRYMPNSNAVTTLSIATSESWRDKQTGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWQDQHGQDRYSTEVVVNVNGSMQMLGSRQRSGSSSSQHQGSQQQGWGQPQQPVSGGQPSQVGPSSTGRTAAG
MPMDFDDDIPF

Nucleotide


Download         Length: 516 bp        

>NTDB_id=461644 HVY70_RS03840 WP_181693904.1 798049..798564(+) (ssb) [Klebsiella oxytoca strain RHB30-C02]
ATGGCTTCACGTGGAATTAACAAAGTCATTCTGGTTGGAAATTTAGGCCAGGATCCTGAAGTGCGCTATATGCCCAACAG
TAACGCAGTGACCACGCTGTCGATAGCGACTTCAGAGAGCTGGCGCGATAAGCAAACCGGCGAAATGAAAGAGCAGACCG
AATGGCACCGTGTTGTGCTGTTTGGCAAACTGGCGGAAGTGGCCAGTGAATATCTGCGTAAAGGCTCGCAGGTGTATATT
GAAGGCCAGTTACGTACCCGTAAATGGCAGGATCAGCATGGCCAGGATCGTTATTCTACCGAAGTGGTGGTCAACGTGAA
CGGTAGCATGCAGATGCTGGGGAGTCGTCAACGGTCGGGTAGCTCCTCTTCCCAACACCAGGGCTCTCAACAGCAGGGAT
GGGGACAACCTCAGCAGCCTGTATCAGGTGGTCAGCCGTCTCAGGTTGGGCCGTCGTCAACCGGACGCACCGCTGCCGGC
ATGCCGATGGATTTTGACGACGATATCCCCTTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

67.232

100

0.696

  ssb Glaesserella parasuis strain SC1401

52.973

100

0.573

  ssb Neisseria gonorrhoeae MS11

42.938

100

0.444

  ssb Neisseria meningitidis MC58

42.614

100

0.439

  ssbA Bacillus subtilis subsp. subtilis str. 168

35.593

100

0.368