Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   HT135_RS13365 Genome accession   NZ_CP054584
Coordinates   2608046..2608420 (-) Length   124 a.a.
NCBI ID   WP_106020094.1    Uniprot ID   -
Organism   Bacillus halotolerans strain KKD1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2603046..2613420
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HT135_RS13325 (HT135_13320) - 2603382..2604176 (+) 795 WP_106020090.1 YqhG family protein -
  HT135_RS13330 (HT135_13325) sinI 2604360..2604533 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  HT135_RS13335 (HT135_13330) sinR 2604567..2604902 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HT135_RS13340 (HT135_13335) tasA 2604989..2605774 (-) 786 WP_106020091.1 biofilm matrix protein TasA -
  HT135_RS13345 (HT135_13340) sipW 2605839..2606423 (-) 585 WP_106020092.1 signal peptidase I SipW -
  HT135_RS13350 (HT135_13345) tapA 2606395..2607156 (-) 762 WP_106020093.1 amyloid fiber anchoring/assembly protein TapA -
  HT135_RS13355 (HT135_13350) - 2607433..2607756 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  HT135_RS13360 (HT135_13355) - 2607799..2607978 (-) 180 WP_003236949.1 YqzE family protein -
  HT135_RS13365 (HT135_13360) comGG 2608046..2608420 (-) 375 WP_106020094.1 competence type IV pilus minor pilin ComGG Machinery gene
  HT135_RS13370 (HT135_13365) comGF 2608421..2608804 (-) 384 WP_038954226.1 competence type IV pilus minor pilin ComGF Machinery gene
  HT135_RS13375 (HT135_13370) comGE 2608830..2609177 (-) 348 WP_106020095.1 competence type IV pilus minor pilin ComGE Machinery gene
  HT135_RS13380 (HT135_13375) comGD 2609161..2609592 (-) 432 WP_103672268.1 competence type IV pilus minor pilin ComGD Machinery gene
  HT135_RS13385 (HT135_13380) comGC 2609582..2609878 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  HT135_RS13390 (HT135_13385) comGB 2609892..2610929 (-) 1038 WP_106020096.1 competence type IV pilus assembly protein ComGB Machinery gene
  HT135_RS13395 (HT135_13390) comGA 2610916..2611986 (-) 1071 WP_095713275.1 competence protein ComGA Machinery gene
  HT135_RS13400 (HT135_13395) - 2612307..2612717 (-) 411 WP_106020097.1 CBS domain-containing protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14484.58 Da        Isoelectric Point: 9.2100

>NTDB_id=453718 HT135_RS13365 WP_106020094.1 2608046..2608420(-) (comGG) [Bacillus halotolerans strain KKD1]
MYYSKGFIYPAVLFTFALVMLIVNFTAPQFVSRHMFEQETKEYYTGENLLQNGALLSIRHILEHRPGRKGSQQFQYGHVS
YDIRKTTIKEQQEITLKAITESGTEKSAQLLFDQNQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=453718 HT135_RS13365 WP_106020094.1 2608046..2608420(-) (comGG) [Bacillus halotolerans strain KKD1]
ATGTACTACTCAAAAGGGTTTATCTATCCGGCCGTTCTTTTTACATTTGCCCTTGTGATGCTGATTGTGAATTTCACCGC
CCCTCAATTTGTTTCACGCCATATGTTTGAGCAGGAAACAAAAGAGTATTACACAGGAGAAAATCTGCTGCAAAATGGCG
CGCTTCTATCCATCAGGCATATACTTGAGCACAGACCAGGCCGAAAGGGTTCACAGCAGTTTCAATATGGACATGTATCT
TATGACATTCGCAAAACAACCATAAAAGAACAGCAAGAAATCACTCTTAAAGCCATCACAGAGTCGGGAACAGAAAAAAG
CGCTCAGCTGCTGTTCGATCAAAATCAGAAAAAACTGCTGAGCTGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(31-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

68.548

100

0.685