Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   I6I02_RS00140 Genome accession   NZ_CP066093
Coordinates   35626..35856 (+) Length   76 a.a.
NCBI ID   WP_051412000.1    Uniprot ID   -
Organism   Streptococcus salivarius strain FDAARGOS_1045     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30626..40856
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6I02_RS00115 (I6I02_00115) - 32517..32879 (+) 363 WP_002887019.1 DUF1033 family protein -
  I6I02_RS00120 (I6I02_00120) comGA/cglA/cilD 32960..33901 (+) 942 WP_060971595.1 competence type IV pilus ATPase ComGA Machinery gene
  I6I02_RS00125 (I6I02_00125) comGB 33783..34883 (+) 1101 WP_198463594.1 competence type IV pilus assembly protein ComGB Machinery gene
  I6I02_RS00130 (I6I02_00130) comGC 34880..35206 (+) 327 WP_002885815.1 competence type IV pilus major pilin ComGC Machinery gene
  I6I02_RS00135 (I6I02_00135) comGD 35166..35594 (+) 429 WP_269780043.1 competence type IV pilus minor pilin ComGD Machinery gene
  I6I02_RS00140 (I6I02_00140) comGE 35626..35856 (+) 231 WP_051412000.1 competence type IV pilus minor pilin ComGE Machinery gene
  I6I02_RS00145 (I6I02_00145) comGF 35843..36280 (+) 438 WP_037601472.1 competence type IV pilus minor pilin ComGF Machinery gene
  I6I02_RS00150 (I6I02_00150) comGG 36258..36575 (+) 318 WP_041817287.1 competence type IV pilus minor pilin ComGG Machinery gene
  I6I02_RS00155 (I6I02_00155) comGH 36620..37576 (+) 957 WP_013991262.1 class I SAM-dependent methyltransferase Machinery gene
  I6I02_RS00160 (I6I02_00160) - 37633..38826 (+) 1194 WP_003095894.1 acetate kinase -
  I6I02_RS00165 (I6I02_00165) - 39077..39274 (+) 198 WP_013991261.1 helix-turn-helix transcriptional regulator -
  I6I02_RS00170 (I6I02_00170) - 39286..39942 (+) 657 WP_013991260.1 CPBP family intramembrane glutamic endopeptidase -
  I6I02_RS00175 (I6I02_00175) - 40016..40462 (+) 447 WP_013991259.1 hypothetical protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.87 Da        Isoelectric Point: 10.6777

>NTDB_id=453716 I6I02_RS00140 WP_051412000.1 35626..35856(+) (comGE) [Streptococcus salivarius strain FDAARGOS_1045]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGIAVYESGKEIIHVSK

Nucleotide


Download         Length: 231 bp        

>NTDB_id=453716 I6I02_RS00140 WP_051412000.1 35626..35856(+) (comGE) [Streptococcus salivarius strain FDAARGOS_1045]
ATGGCTGTCTTAGTGCTTGTCAGTGGTCTTATATTAGATCAAATCAATACCAATCGTAGGTTAATGGCTAGGAATCTCCA
CCAACAGGAGGTTTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGTATCACAGTGA
CAGTAAAACGTAGCAAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

38.158

100

0.382

  comGE Streptococcus mutans UA159

38.158

100

0.382