Detailed information NTG0452807

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: I6H76_RS05090
• Genome accession: NZ_CP065994
• Coordinates: 1010216..1010566 (-)
• Length: 116 a.a.
• NCBI ID: WP_043878322.1
• Uniprot ID: -
• Organism: Streptococcus infantarius strain FDAARGOS_1019
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1005216..1015566

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
I6H76_RS05055 (I6H76_05055)	proC	1005470..1006240 (+)	771	WP_006531737.1	pyrroline-5-carboxylate reductase	-
I6H76_RS05060 (I6H76_05060)	-	1006275..1006910 (-)	636	WP_014334210.1	CPBP family intramembrane glutamic endopeptidase	-
I6H76_RS05065 (I6H76_05065)	-	1006925..1007380 (-)	456	WP_006531739.1	hypothetical protein	-
I6H76_RS05070 (I6H76_05070)	-	1007381..1007581 (-)	201	WP_006531740.1	hypothetical protein	-
I6H76_RS05075 (I6H76_05075)	-	1007597..1007794 (-)	198	WP_006531741.1	helix-turn-helix transcriptional regulator	-
I6H76_RS05080 (I6H76_05080)	-	1007953..1009152 (-)	1200	WP_006531742.1	acetate kinase	-
I6H76_RS05085 (I6H76_05085)	comGH	1009206..1010162 (-)	957	WP_006531743.1	class I SAM-dependent methyltransferase	Machinery gene
I6H76_RS05090 (I6H76_05090)	comGG	1010216..1010566 (-)	351	WP_043878322.1	competence type IV pilus minor pilin ComGG	Machinery gene
I6H76_RS05095 (I6H76_05095)	comGF	1010538..1010975 (-)	438	WP_006531745.1	competence type IV pilus minor pilin ComGF	Machinery gene
I6H76_RS05100 (I6H76_05100)	comGE	1010959..1011252 (-)	294	WP_006531746.1	competence type IV pilus minor pilin ComGE	Machinery gene
I6H76_RS05105 (I6H76_05105)	comGD	1011206..1011637 (-)	432	WP_006531747.1	competence type IV pilus minor pilin ComGD	Machinery gene
I6H76_RS05110 (I6H76_05110)	comGC/cglC	1011621..1011914 (-)	294	WP_006531748.1	competence type IV pilus major pilin ComGC	Machinery gene
I6H76_RS05115 (I6H76_05115)	comGB	1011914..1012957 (-)	1044	WP_174221225.1	competence type IV pilus assembly protein ComGB	Machinery gene
I6H76_RS05120 (I6H76_05120)	comGA	1012881..1013822 (-)	942	WP_043878331.1	competence type IV pilus ATPase ComGA	Machinery gene
I6H76_RS05125 (I6H76_05125)	-	1013935..1014264 (-)	330	WP_006531751.1	DUF1033 family protein	-

Sequence

Protein

• Length: 116 a.a.
• Molecular weight: 13446.62 Da
• Isoelectric Point: 7.2730

>NTDB_id=452807 I6H76_RS05090 WP_043878322.1 1010216..1010566(-) (comGG) [Streptococcus infantarius strain FDAARGOS_1019]
MFTLLRRQVKAGILLYALLMAAIFALLLQFYLGRVVASERQHQAQIKSAQAYLMAEMSKDLADEESGQCQFDKGTVSYHY
KDKLLVETVMLDSKEEFQYTFYLPKKEKQALEKESH

Nucleotide

• Length: 351 bp

>NTDB_id=452807 I6H76_RS05090 WP_043878322.1 1010216..1010566(-) (comGG) [Streptococcus infantarius strain FDAARGOS_1019]
TTGTTTACACTTTTGAGACGACAAGTTAAAGCGGGAATTTTATTATATGCTTTACTGATGGCGGCTATCTTTGCCCTGCT
TTTGCAATTTTATTTGGGGCGCGTGGTTGCAAGTGAGCGTCAGCATCAAGCTCAGATAAAATCAGCCCAAGCTTACCTGA
TGGCAGAAATGAGTAAAGACTTGGCTGATGAGGAATCAGGACAATGCCAATTTGATAAAGGAACAGTAAGTTATCACTAC
AAAGACAAACTCTTAGTAGAGACCGTTATGTTAGATAGCAAAGAGGAGTTTCAATACACGTTTTATCTTCCTAAGAAAGA
AAAACAAGCACTTGAAAAAGAAAGTCACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	47.17	91.379	0.431
comGG	Streptococcus mutans UA159	47.17	91.379	0.431
comGG/cglG	Streptococcus mitis NCTC 12261	45.455	85.345	0.388
comGG/cglG	Streptococcus pneumoniae Rx1	44.444	85.345	0.379
comGG/cglG	Streptococcus pneumoniae D39	44.444	85.345	0.379
comGG/cglG	Streptococcus pneumoniae R6	44.444	85.345	0.379
comGG/cglG	Streptococcus pneumoniae TIGR4	44.444	85.345	0.379