Detailed information NTG0452811

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: I6H76_RS05110
• Genome accession: NZ_CP065994
• Coordinates: 1011621..1011914 (-)
• Length: 97 a.a.
• NCBI ID: WP_006531748.1
• Uniprot ID: A0ABP2DLV7
• Organism: Streptococcus infantarius strain FDAARGOS_1019
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1006621..1016914

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
I6H76_RS05065 (I6H76_05065)	-	1006925..1007380 (-)	456	WP_006531739.1	hypothetical protein	-
I6H76_RS05070 (I6H76_05070)	-	1007381..1007581 (-)	201	WP_006531740.1	hypothetical protein	-
I6H76_RS05075 (I6H76_05075)	-	1007597..1007794 (-)	198	WP_006531741.1	helix-turn-helix transcriptional regulator	-
I6H76_RS05080 (I6H76_05080)	-	1007953..1009152 (-)	1200	WP_006531742.1	acetate kinase	-
I6H76_RS05085 (I6H76_05085)	comGH	1009206..1010162 (-)	957	WP_006531743.1	class I SAM-dependent methyltransferase	Machinery gene
I6H76_RS05090 (I6H76_05090)	comGG	1010216..1010566 (-)	351	WP_043878322.1	competence type IV pilus minor pilin ComGG	Machinery gene
I6H76_RS05095 (I6H76_05095)	comGF	1010538..1010975 (-)	438	WP_006531745.1	competence type IV pilus minor pilin ComGF	Machinery gene
I6H76_RS05100 (I6H76_05100)	comGE	1010959..1011252 (-)	294	WP_006531746.1	competence type IV pilus minor pilin ComGE	Machinery gene
I6H76_RS05105 (I6H76_05105)	comGD	1011206..1011637 (-)	432	WP_006531747.1	competence type IV pilus minor pilin ComGD	Machinery gene
I6H76_RS05110 (I6H76_05110)	comGC/cglC	1011621..1011914 (-)	294	WP_006531748.1	competence type IV pilus major pilin ComGC	Machinery gene
I6H76_RS05115 (I6H76_05115)	comGB	1011914..1012957 (-)	1044	WP_174221225.1	competence type IV pilus assembly protein ComGB	Machinery gene
I6H76_RS05120 (I6H76_05120)	comGA	1012881..1013822 (-)	942	WP_043878331.1	competence type IV pilus ATPase ComGA	Machinery gene
I6H76_RS05125 (I6H76_05125)	-	1013935..1014264 (-)	330	WP_006531751.1	DUF1033 family protein	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 10914.02 Da
• Isoelectric Point: 8.8640

>NTDB_id=452811 I6H76_RS05110 WP_006531748.1 1011621..1011914(-) (comGC/cglC) [Streptococcus infantarius strain FDAARGOS_1019]
MKKIWKKLCKKSVEAFTLVEMLIVLLIIGVLMLLFVPNLSKQKDVVHEKGDAAVVKVVDSQMDLYEVKTGDKASVDDLVD
VGYITKEQAKTYNEAKK

Nucleotide

• Length: 294 bp

>NTDB_id=452811 I6H76_RS05110 WP_006531748.1 1011621..1011914(-) (comGC/cglC) [Streptococcus infantarius strain FDAARGOS_1019]
ATGAAAAAAATTTGGAAAAAACTATGTAAAAAGTCTGTGGAAGCTTTCACACTTGTGGAGATGTTGATTGTTTTGCTAAT
CATTGGTGTATTAATGCTTTTATTTGTGCCAAATTTGAGTAAGCAAAAGGATGTTGTGCATGAAAAAGGAGATGCTGCTG
TTGTGAAAGTTGTCGACAGTCAGATGGACCTTTATGAAGTGAAGACAGGCGATAAGGCAAGTGTTGATGATTTAGTAGAC
GTTGGCTACATTACGAAAGAGCAAGCCAAAACCTATAATGAAGCTAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (13-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis SK321	61.702	96.907	0.598
comGC	Streptococcus suis isolate S10	63.043	94.845	0.598
comGC/cglC	Streptococcus mitis NCTC 12261	60.638	96.907	0.588
comGC/cglC	Streptococcus pneumoniae D39	60.638	96.907	0.588
comGC/cglC	Streptococcus pneumoniae R6	60.638	96.907	0.588
comGC/cglC	Streptococcus pneumoniae Rx1	60.638	96.907	0.588
comGC/cglC	Streptococcus pneumoniae TIGR4	60.638	96.907	0.588
comGC	Streptococcus gordonii str. Challis substr. CH1	64.368	89.691	0.577
comGC	Streptococcus mutans UA140	59.77	89.691	0.536
comGC	Streptococcus mutans UA159	59.77	89.691	0.536
comGC	Lactococcus lactis subsp. cremoris KW2	53.333	92.784	0.495
comGC	Staphylococcus aureus MW2	45.122	84.536	0.381
comGC	Staphylococcus aureus N315	45.122	84.536	0.381
comGC	Latilactobacillus sakei subsp. sakei 23K	43.023	88.66	0.381