Detailed information NTG0445443

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: HO396_RS17990
• Genome accession: NZ_CP053602
• Coordinates: 3714104..3714589 (+)
• Length: 161 a.a.
• NCBI ID: WP_000157061.1
• Uniprot ID: A0AAU7IP99
• Organism: Escherichia coli BL21(DE3)
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3705391..3723941	3714104..3714589	within	0

Gene organization within MGE regions

Location: 3705391..3723941

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HO396_RS17965 (HO396_17970)	-	3705391..3706575 (+)	1185	WP_001218910.1	integrase arm-type DNA-binding domain-containing protein	-
HO396_RS17970 (HO396_17975)	-	3706986..3708029 (+)	1044	WP_000999851.1	hypothetical protein	-
HO396_RS17975 (HO396_17980)	-	3708427..3709497 (-)	1071	WP_000412404.1	LacI family DNA-binding transcriptional regulator	-
HO396_RS17980 (HO396_17985)	-	3709759..3711060 (+)	1302	WP_001329026.1	MFS transporter	-
HO396_RS17985 (HO396_17990)	-	3711075..3713456 (+)	2382	WP_001313395.1	glycoside hydrolase family 31 protein	-
HO396_RS22445	ykgR	3713637..3713738 (+)	102	WP_001313396.1	small membrane protein YkgR	-
HO396_RS17990 (HO396_17995)	ssb	3714104..3714589 (+)	486	WP_000157061.1	single-stranded DNA-binding protein	Machinery gene
HO396_RS18000 (HO396_18005)	-	3715654..3716000 (-)	347	Protein_3557	transposase	-
HO396_RS18005 (HO396_18010)	-	3716036..3716491 (-)	456	Protein_3558	hypothetical protein	-
HO396_RS18010 (HO396_18015)	-	3716540..3716695 (-)	156	WP_000074142.1	hypothetical protein	-
HO396_RS18015 (HO396_18020)	-	3717315..3717695 (+)	381	Protein_3560	integrase core domain-containing protein	-
HO396_RS18020 (HO396_18025)	-	3717974..3721471 (+)	3498	WP_001038839.1	autotransporter outer membrane beta-barrel domain-containing protein	-
HO396_RS18025 (HO396_18030)	-	3721646..3721851 (-)	206	Protein_3562	hypothetical protein	-
HO396_RS22285	-	3721850..3721963 (+)	114	Protein_3563	alkaline phosphatase	-
HO396_RS22290	-	3722331..3722525 (-)	195	Protein_3564	hypothetical protein	-
HO396_RS18035 (HO396_18040)	-	3722504..3722749 (+)	246	Protein_3565	transposase	-
HO396_RS18040 (HO396_18045)	-	3722817..3723863 (+)	1047	Protein_3566	IS30-like element IS30 family transposase	-

Sequence

Protein

• Length: 161 a.a.
• Molecular weight: 17685.62 Da
• Isoelectric Point: 7.2017

>NTDB_id=445443 HO396_RS17990 WP_000157061.1 3714104..3714589(+) (ssb) [Escherichia coli BL21(DE3)]
MASKGINKVILIGYLGQDPDIRYMPNGGAVASIALATSETWRDKQTGEMREQTEWHRVVLFGKLAEVASEYLRKGAQVYI
DGQLRTRKWTDQTGQERYTTEVVVHTGGTMQMLGSRQNSAQGGRGQPQQPQQGRQFSGNSPSPGNTAMSGSFSDDDDSIP
F

Nucleotide

• Length: 486 bp

>NTDB_id=445443 HO396_RS17990 WP_000157061.1 3714104..3714589(+) (ssb) [Escherichia coli BL21(DE3)]
ATGGCCTCTAAAGGTATTAACAAAGTTATTCTGATAGGGTATCTGGGTCAGGACCCGGATATTCGCTATATGCCAAACGG
CGGCGCTGTGGCCAGCATTGCGCTGGCCACCTCCGAAACCTGGCGGGACAAACAGACAGGGGAGATGCGGGAACAAACCG
AATGGCACCGCGTGGTGCTGTTCGGCAAACTGGCGGAAGTAGCCAGTGAATACCTGCGCAAAGGAGCTCAGGTGTACATC
GATGGTCAGCTGCGTACCCGAAAATGGACCGACCAGACCGGCCAGGAACGCTACACGACTGAAGTGGTGGTGCATACCGG
CGGTACCATGCAGATGCTGGGCTCCCGGCAGAATAGTGCACAGGGTGGCCGGGGACAGCCTCAACAACCACAACAGGGCA
GACAGTTTTCAGGTAATTCGCCATCTCCGGGCAATACCGCCATGTCCGGCAGTTTCAGCGACGATGACGACAGTATCCCG
TTCTGA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (6-112)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Vibrio cholerae strain A1552	58.757	100	0.646
ssb	Glaesserella parasuis strain SC1401	52.632	94.41	0.497
ssb	Neisseria meningitidis MC58	41.477	100	0.453
ssb	Neisseria gonorrhoeae MS11	41.477	100	0.453
ssb	Latilactobacillus sakei subsp. sakei 23K	32.402	100	0.36