Detailed information NTG0445302

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: HO403_RS03500
• Genome accession: NZ_CP053592
• Coordinates: 744448..744933 (-)
• Length: 161 a.a.
• NCBI ID: WP_000157061.1
• Uniprot ID: A0AAU7IP99
• Organism: Escherichia coli strain NEBExpress_Iq
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	736177..753646	744448..744933	within	0

Gene organization within MGE regions

Location: 736177..753646

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HO403_RS03455 (HO403_03455)	-	736288..736533 (-)	246	Protein_668	transposase	-
HO403_RS21840	-	736512..736706 (+)	195	Protein_669	hypothetical protein	-
HO403_RS21845	-	737074..737187 (-)	114	Protein_670	alkaline phosphatase	-
HO403_RS03465 (HO403_03465)	-	737186..737391 (+)	206	Protein_671	hypothetical protein	-
HO403_RS03470 (HO403_03470)	-	737566..741063 (-)	3498	WP_001038839.1	autotransporter outer membrane beta-barrel domain-containing protein	-
HO403_RS03475 (HO403_03475)	-	741342..741722 (-)	381	Protein_673	integrase core domain-containing protein	-
HO403_RS03480 (HO403_03480)	-	742342..742497 (+)	156	WP_000074142.1	hypothetical protein	-
HO403_RS03485 (HO403_03485)	-	742546..743001 (+)	456	Protein_675	hypothetical protein	-
HO403_RS03490 (HO403_03490)	-	743037..743383 (+)	347	Protein_676	transposase	-
HO403_RS03500 (HO403_03500)	ssb	744448..744933 (-)	486	WP_000157061.1	single-stranded DNA-binding protein	Machinery gene
HO403_RS22075	ykgR	745299..745400 (-)	102	WP_001313396.1	small membrane protein YkgR	-
HO403_RS03505 (HO403_03505)	-	745581..747962 (-)	2382	WP_001313395.1	glycoside hydrolase family 31 protein	-
HO403_RS03510 (HO403_03510)	-	747977..749278 (-)	1302	WP_001329026.1	MFS transporter	-
HO403_RS03515 (HO403_03515)	-	749540..750610 (+)	1071	WP_000412404.1	LacI family DNA-binding transcriptional regulator	-
HO403_RS03520 (HO403_03520)	-	751008..752051 (-)	1044	WP_000999851.1	hypothetical protein	-
HO403_RS03525 (HO403_03525)	-	752462..753646 (-)	1185	WP_001218910.1	integrase arm-type DNA-binding domain-containing protein	-

Sequence

Protein

• Length: 161 a.a.
• Molecular weight: 17685.62 Da
• Isoelectric Point: 7.2017

>NTDB_id=445302 HO403_RS03500 WP_000157061.1 744448..744933(-) (ssb) [Escherichia coli strain NEBExpress_Iq]
MASKGINKVILIGYLGQDPDIRYMPNGGAVASIALATSETWRDKQTGEMREQTEWHRVVLFGKLAEVASEYLRKGAQVYI
DGQLRTRKWTDQTGQERYTTEVVVHTGGTMQMLGSRQNSAQGGRGQPQQPQQGRQFSGNSPSPGNTAMSGSFSDDDDSIP
F

Nucleotide

• Length: 486 bp

>NTDB_id=445302 HO403_RS03500 WP_000157061.1 744448..744933(-) (ssb) [Escherichia coli strain NEBExpress_Iq]
ATGGCCTCTAAAGGTATTAACAAAGTTATTCTGATAGGGTATCTGGGTCAGGACCCGGATATTCGCTATATGCCAAACGG
CGGCGCTGTGGCCAGCATTGCGCTGGCCACCTCCGAAACCTGGCGGGACAAACAGACAGGGGAGATGCGGGAACAAACCG
AATGGCACCGCGTGGTGCTGTTCGGCAAACTGGCGGAAGTAGCCAGTGAATACCTGCGCAAAGGAGCTCAGGTGTACATC
GATGGTCAGCTGCGTACCCGAAAATGGACCGACCAGACCGGCCAGGAACGCTACACGACTGAAGTGGTGGTGCATACCGG
CGGTACCATGCAGATGCTGGGCTCCCGGCAGAATAGTGCACAGGGTGGCCGGGGACAGCCTCAACAACCACAACAGGGCA
GACAGTTTTCAGGTAATTCGCCATCTCCGGGCAATACCGCCATGTCCGGCAGTTTCAGCGACGATGACGACAGTATCCCG
TTCTGA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (6-112)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Vibrio cholerae strain A1552	58.757	100	0.646
ssb	Glaesserella parasuis strain SC1401	52.632	94.41	0.497
ssb	Neisseria meningitidis MC58	41.477	100	0.453
ssb	Neisseria gonorrhoeae MS11	41.477	100	0.453
ssb	Latilactobacillus sakei subsp. sakei 23K	32.402	100	0.36