Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ITP52_RS19770 Genome accession   NZ_CP064818
Coordinates   3870097..3870480 (+) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain SH1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3865097..3875480
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ITP52_RS19740 (ITP52_19740) corA 3865551..3866504 (+) 954 WP_029317911.1 magnesium transporter CorA -
  ITP52_RS19745 (ITP52_19745) comGA 3866915..3867985 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ITP52_RS19750 (ITP52_19750) comGB 3867972..3869009 (+) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  ITP52_RS19755 (ITP52_19755) comGC 3869023..3869319 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ITP52_RS19760 (ITP52_19760) comGD 3869309..3869740 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  ITP52_RS19765 (ITP52_19765) comGE 3869724..3870071 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ITP52_RS19770 (ITP52_19770) comGF 3870097..3870480 (+) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  ITP52_RS19775 (ITP52_19775) comGG 3870481..3870855 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  ITP52_RS19780 (ITP52_19780) spoIITA 3870926..3871105 (+) 180 WP_003230176.1 YqzE family protein -
  ITP52_RS19785 (ITP52_19785) yqzG 3871147..3871473 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  ITP52_RS19790 (ITP52_19790) tapA 3871745..3872506 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  ITP52_RS19795 (ITP52_19795) sipW 3872490..3873062 (+) 573 WP_003246088.1 signal peptidase I SipW -
  ITP52_RS19800 (ITP52_19800) tasA 3873126..3873911 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  ITP52_RS19805 (ITP52_19805) sinR 3874004..3874339 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ITP52_RS19810 (ITP52_19810) sinI 3874373..3874546 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=445068 ITP52_RS19770 WP_041850015.1 3870097..3870480(+) (comGF) [Bacillus subtilis strain SH1]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=445068 ITP52_RS19770 WP_041850015.1 3870097..3870480(+) (comGF) [Bacillus subtilis strain SH1]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984