Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ITP52_RS19810 Genome accession   NZ_CP064818
Coordinates   3874373..3874546 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SH1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3869373..3879546
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ITP52_RS19765 (ITP52_19765) comGE 3869724..3870071 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ITP52_RS19770 (ITP52_19770) comGF 3870097..3870480 (+) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  ITP52_RS19775 (ITP52_19775) comGG 3870481..3870855 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  ITP52_RS19780 (ITP52_19780) spoIITA 3870926..3871105 (+) 180 WP_003230176.1 YqzE family protein -
  ITP52_RS19785 (ITP52_19785) yqzG 3871147..3871473 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  ITP52_RS19790 (ITP52_19790) tapA 3871745..3872506 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  ITP52_RS19795 (ITP52_19795) sipW 3872490..3873062 (+) 573 WP_003246088.1 signal peptidase I SipW -
  ITP52_RS19800 (ITP52_19800) tasA 3873126..3873911 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  ITP52_RS19805 (ITP52_19805) sinR 3874004..3874339 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ITP52_RS19810 (ITP52_19810) sinI 3874373..3874546 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  ITP52_RS19815 (ITP52_19815) yqhG 3874729..3875523 (-) 795 WP_003230200.1 YqhG family protein -
  ITP52_RS19820 (ITP52_19820) hepAA 3875544..3877217 (-) 1674 WP_041850014.1 SNF2-related protein -
  ITP52_RS19825 (ITP52_19825) gcvT 3877658..3878746 (+) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=445071 ITP52_RS19810 WP_003230187.1 3874373..3874546(-) (sinI) [Bacillus subtilis strain SH1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=445071 ITP52_RS19810 WP_003230187.1 3874373..3874546(-) (sinI) [Bacillus subtilis strain SH1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1