Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HG574_RS00220 Genome accession   NZ_CP051541
Coordinates   39996..40109 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain LIM-001     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 34996..45109
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG574_RS00195 (HG574_00195) - 35049..37274 (+) 2226 WP_202144858.1 ATP-dependent Clp protease ATP-binding subunit -
  HG574_RS00200 (HG574_00200) panD 37264..37617 (+) 354 WP_097689164.1 aspartate 1-decarboxylase -
  HG574_RS00205 (HG574_00205) - 37620..37922 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HG574_RS00210 (HG574_00210) - 37922..38917 (+) 996 WP_202145298.1 PDZ domain-containing protein -
  HG574_RS00215 (HG574_00215) comB6 38925..39980 (+) 1056 WP_202145297.1 P-type conjugative transfer protein TrbL Machinery gene
  HG574_RS00220 (HG574_00220) comB7 39996..40109 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HG574_RS00225 (HG574_00225) comB8 40106..40849 (+) 744 WP_202144859.1 virB8 family protein Machinery gene
  HG574_RS00230 (HG574_00230) comB9 40849..41835 (+) 987 WP_202144860.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG574_RS00235 (HG574_00235) comB10 41828..42958 (+) 1131 WP_202144861.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG574_RS00240 (HG574_00240) - 43029..44456 (+) 1428 WP_202144862.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=439678 HG574_RS00220 WP_001217873.1 39996..40109(+) (comB7) [Helicobacter pylori strain LIM-001]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=439678 HG574_RS00220 WP_001217873.1 39996..40109(+) (comB7) [Helicobacter pylori strain LIM-001]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1