Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HG581_RS00200 Genome accession   NZ_CP051535
Coordinates   37406..37519 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain LIM-008     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 32406..42519
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG581_RS00175 (HG581_00175) - 32462..34684 (+) 2223 WP_202138051.1 ATP-dependent Clp protease ATP-binding subunit -
  HG581_RS00180 (HG581_00180) panD 34674..35027 (+) 354 WP_024368743.1 aspartate 1-decarboxylase -
  HG581_RS00185 (HG581_00185) - 35030..35332 (+) 303 WP_202138052.1 YbaB/EbfC family nucleoid-associated protein -
  HG581_RS00190 (HG581_00190) - 35332..36327 (+) 996 WP_202138491.1 PDZ domain-containing protein -
  HG581_RS00195 (HG581_00195) comB6 36335..37390 (+) 1056 WP_202138490.1 P-type conjugative transfer protein TrbL Machinery gene
  HG581_RS00200 (HG581_00200) comB7 37406..37519 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HG581_RS00205 (HG581_00205) comB8 37516..38253 (+) 738 WP_202138053.1 virB8 family protein Machinery gene
  HG581_RS00210 (HG581_00210) comB9 38253..39230 (+) 978 WP_202138054.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG581_RS00215 (HG581_00215) comB10 39223..40353 (+) 1131 WP_202138055.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG581_RS00220 (HG581_00220) - 40424..41836 (+) 1413 WP_202138056.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=439573 HG581_RS00200 WP_001217873.1 37406..37519(+) (comB7) [Helicobacter pylori strain LIM-008]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=439573 HG581_RS00200 WP_001217873.1 37406..37519(+) (comB7) [Helicobacter pylori strain LIM-008]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTATATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1