Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   GYO_RS34585 Genome accession   NC_016047
Coordinates   2536804..2537178 (-) Length   124 a.a.
NCBI ID   WP_014114394.1    Uniprot ID   G4NQ90
Organism   Bacillus spizizenii TU-B-10     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2531804..2542178
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GYO_RS34545 (GYO_2719) - 2532132..2532926 (+) 795 WP_014114389.1 YqhG family protein -
  GYO_RS34550 (GYO_2720) sinI 2533112..2533285 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  GYO_RS34555 (GYO_2721) sinR 2533319..2533654 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GYO_RS34560 (GYO_2722) tasA 2533748..2534533 (-) 786 WP_014114390.1 biofilm matrix protein TasA -
  GYO_RS34565 (GYO_2723) sipW 2534597..2535169 (-) 573 WP_014114391.1 signal peptidase I SipW -
  GYO_RS34570 (GYO_2724) tapA 2535153..2535914 (-) 762 WP_014114392.1 amyloid fiber anchoring/assembly protein TapA -
  GYO_RS34575 (GYO_2725) - 2536185..2536511 (+) 327 WP_014114393.1 YqzG/YhdC family protein -
  GYO_RS34580 (GYO_2726) - 2536553..2536732 (-) 180 WP_003226330.1 YqzE family protein -
  GYO_RS34585 (GYO_2727) comGG 2536804..2537178 (-) 375 WP_014114394.1 competence type IV pilus minor pilin ComGG Machinery gene
  GYO_RS34590 comGF 2537179..2537562 (-) 384 WP_041520999.1 competence type IV pilus minor pilin ComGF Machinery gene
  GYO_RS34595 (GYO_2731) comGE 2537588..2537935 (-) 348 WP_014114398.1 competence type IV pilus minor pilin ComGE Machinery gene
  GYO_RS34600 (GYO_2732) comGD 2537919..2538350 (-) 432 WP_014114399.1 competence type IV pilus minor pilin ComGD Machinery gene
  GYO_RS34605 (GYO_2733) comGC 2538340..2538636 (-) 297 WP_014114400.1 comG operon protein ComGC Machinery gene
  GYO_RS34610 (GYO_2734) comGB 2538650..2539687 (-) 1038 WP_014114401.1 competence type IV pilus assembly protein ComGB Machinery gene
  GYO_RS34615 (GYO_2735) comGA 2539674..2540744 (-) 1071 WP_014114402.1 competence protein ComGA Machinery gene
  GYO_RS34625 (GYO_2736) - 2540958..2541368 (-) 411 WP_014114403.1 CBS domain-containing protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14303.33 Da        Isoelectric Point: 7.9624

>NTDB_id=42590 GYO_RS34585 WP_014114394.1 2536804..2537178(-) (comGG) [Bacillus spizizenii TU-B-10]
MDSTKGFIYPAVLFVSALVLLSVNFTAAQYISRCMFEKETKEFYTGENLLQNGALLSIRHVLEQRKGQKDSQQFPYGQVS
YYIYDTSIKEQKEINLKALTESGTERTAQIVFDQKQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=42590 GYO_RS34585 WP_014114394.1 2536804..2537178(-) (comGG) [Bacillus spizizenii TU-B-10]
ATGGACAGCACGAAAGGGTTTATTTATCCCGCTGTTCTTTTTGTGTCCGCGCTTGTGCTGCTGAGCGTGAACTTTACTGC
TGCGCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTTTACACAGGAGAGAATTTGCTTCAGAATGGCG
CGCTTCTGTCAATTCGGCATGTTCTTGAGCAGCGGAAAGGCCAAAAGGATTCACAGCAGTTTCCATATGGGCAGGTTTCT
TATTACATTTACGATACATCGATAAAAGAGCAAAAAGAAATCAACCTAAAAGCGTTGACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGCTGGACAGAATAG

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NQ90

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

83.871

100

0.839


Multiple sequence alignment