Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GYO_RS34550 Genome accession   NC_016047
Coordinates   2533112..2533285 (+) Length   57 a.a.
NCBI ID   WP_003226347.1    Uniprot ID   G4NQ83
Organism   Bacillus spizizenii TU-B-10     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2528112..2538285
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GYO_RS34535 (GYO_2717) gcvT 2528905..2529993 (-) 1089 WP_014114387.1 glycine cleavage system aminomethyltransferase GcvT -
  GYO_RS34540 (GYO_2718) - 2530438..2532111 (+) 1674 WP_014114388.1 DEAD/DEAH box helicase -
  GYO_RS34545 (GYO_2719) - 2532132..2532926 (+) 795 WP_014114389.1 YqhG family protein -
  GYO_RS34550 (GYO_2720) sinI 2533112..2533285 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  GYO_RS34555 (GYO_2721) sinR 2533319..2533654 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GYO_RS34560 (GYO_2722) tasA 2533748..2534533 (-) 786 WP_014114390.1 biofilm matrix protein TasA -
  GYO_RS34565 (GYO_2723) sipW 2534597..2535169 (-) 573 WP_014114391.1 signal peptidase I SipW -
  GYO_RS34570 (GYO_2724) tapA 2535153..2535914 (-) 762 WP_014114392.1 amyloid fiber anchoring/assembly protein TapA -
  GYO_RS34575 (GYO_2725) - 2536185..2536511 (+) 327 WP_014114393.1 YqzG/YhdC family protein -
  GYO_RS34580 (GYO_2726) - 2536553..2536732 (-) 180 WP_003226330.1 YqzE family protein -
  GYO_RS34585 (GYO_2727) comGG 2536804..2537178 (-) 375 WP_014114394.1 competence type IV pilus minor pilin ComGG Machinery gene
  GYO_RS34590 comGF 2537179..2537562 (-) 384 WP_041520999.1 competence type IV pilus minor pilin ComGF Machinery gene
  GYO_RS34595 (GYO_2731) comGE 2537588..2537935 (-) 348 WP_014114398.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6632.64 Da        Isoelectric Point: 8.6596

>NTDB_id=42588 GYO_RS34550 WP_003226347.1 2533112..2533285(+) (sinI) [Bacillus spizizenii TU-B-10]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=42588 GYO_RS34550 WP_003226347.1 2533112..2533285(+) (sinI) [Bacillus spizizenii TU-B-10]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NQ83

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965


Multiple sequence alignment