Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   G3M68_RS03400 Genome accession   NZ_CP048600
Coordinates   727144..727257 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain GCT 43     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 722144..732257
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G3M68_RS03380 (G3M68_03380) - 722810..724222 (-) 1413 WP_097702464.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  G3M68_RS03385 (G3M68_03385) comB10 724292..725428 (-) 1137 WP_097702463.1 DNA type IV secretion system protein ComB10 Machinery gene
  G3M68_RS03390 (G3M68_03390) comB9 725421..726404 (-) 984 WP_163497925.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  G3M68_RS03395 (G3M68_03395) comB8 726404..727147 (-) 744 WP_163497926.1 virB8 family protein Machinery gene
  G3M68_RS03400 (G3M68_03400) comB7 727144..727257 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  G3M68_RS03405 (G3M68_03405) comB6 727273..728328 (-) 1056 WP_163498375.1 P-type conjugative transfer protein TrbL Machinery gene
  G3M68_RS03410 (G3M68_03410) - 728336..729340 (-) 1005 WP_163498376.1 PDZ domain-containing protein -
  G3M68_RS03415 (G3M68_03415) - 729340..729642 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  G3M68_RS03420 (G3M68_03420) panD 729645..729998 (-) 354 WP_000142247.1 aspartate 1-decarboxylase -
  G3M68_RS03425 (G3M68_03425) - 729988..732216 (-) 2229 WP_163497927.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=421688 G3M68_RS03400 WP_001217873.1 727144..727257(-) (comB7) [Helicobacter pylori strain GCT 43]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=421688 G3M68_RS03400 WP_001217873.1 727144..727257(-) (comB7) [Helicobacter pylori strain GCT 43]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment