Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | NIT79A3_RS12040 | Genome accession | NC_015731 |
| Coordinates | 2586885..2587331 (+) | Length | 148 a.a. |
| NCBI ID | WP_013966464.1 | Uniprot ID | F8GEK6 |
| Organism | Nitrosomonas sp. Is79A3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2546061..2593473 | 2586885..2587331 | within | 0 |
Gene organization within MGE regions
Location: 2546061..2593473
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIT79A3_RS11750 (Nit79A3_2385) | - | 2546061..2546987 (-) | 927 | WP_013966410.1 | hypothetical protein | - |
| NIT79A3_RS11755 (Nit79A3_2386) | - | 2547196..2548272 (-) | 1077 | WP_156797075.1 | hypothetical protein | - |
| NIT79A3_RS11760 (Nit79A3_2387) | - | 2548351..2548536 (-) | 186 | WP_013966412.1 | DUF2130 domain-containing protein | - |
| NIT79A3_RS19155 | - | 2548508..2548738 (-) | 231 | WP_198009446.1 | hypothetical protein | - |
| NIT79A3_RS11770 (Nit79A3_2388) | - | 2549072..2549434 (+) | 363 | WP_013966413.1 | hypothetical protein | - |
| NIT79A3_RS19540 | - | 2549526..2551022 (-) | 1497 | WP_348225614.1 | hypothetical protein | - |
| NIT79A3_RS19545 | - | 2551077..2551325 (+) | 249 | WP_348225615.1 | hypothetical protein | - |
| NIT79A3_RS11780 (Nit79A3_2390) | - | 2551961..2552275 (-) | 315 | WP_013966415.1 | hypothetical protein | - |
| NIT79A3_RS11785 (Nit79A3_2391) | - | 2552337..2552855 (-) | 519 | WP_013966416.1 | hypothetical protein | - |
| NIT79A3_RS11790 (Nit79A3_2392) | - | 2552895..2553218 (-) | 324 | WP_013966417.1 | phage holin family protein | - |
| NIT79A3_RS11795 (Nit79A3_2393) | - | 2553235..2553531 (-) | 297 | WP_013966418.1 | hypothetical protein | - |
| NIT79A3_RS11800 (Nit79A3_2394) | - | 2553595..2554119 (-) | 525 | WP_198009352.1 | DUF4376 domain-containing protein | - |
| NIT79A3_RS11805 (Nit79A3_2395) | - | 2554154..2555872 (-) | 1719 | WP_013966420.1 | hypothetical protein | - |
| NIT79A3_RS11810 (Nit79A3_2396) | - | 2555876..2556814 (-) | 939 | WP_013966421.1 | hypothetical protein | - |
| NIT79A3_RS11815 (Nit79A3_2397) | - | 2556811..2560398 (-) | 3588 | WP_013966422.1 | hypothetical protein | - |
| NIT79A3_RS11820 (Nit79A3_2398) | - | 2560398..2560751 (-) | 354 | WP_013966423.1 | DUF1799 domain-containing protein | - |
| NIT79A3_RS11825 (Nit79A3_2399) | - | 2560769..2561095 (-) | 327 | WP_013966424.1 | hypothetical protein | - |
| NIT79A3_RS11830 (Nit79A3_2400) | - | 2561151..2562083 (-) | 933 | WP_013966425.1 | phage tail tube protein | - |
| NIT79A3_RS11835 (Nit79A3_2401) | - | 2562096..2562440 (-) | 345 | WP_013966426.1 | hypothetical protein | - |
| NIT79A3_RS17910 (Nit79A3_2402) | - | 2562455..2562937 (-) | 483 | WP_013966427.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| NIT79A3_RS11850 (Nit79A3_2403) | - | 2562927..2563274 (-) | 348 | WP_013966428.1 | phage head closure protein | - |
| NIT79A3_RS11855 (Nit79A3_2404) | - | 2563275..2563844 (-) | 570 | WP_013966429.1 | phage head-tail connector protein | - |
| NIT79A3_RS11860 (Nit79A3_2405) | - | 2563902..2564177 (-) | 276 | WP_013966430.1 | hypothetical protein | - |
| NIT79A3_RS11865 (Nit79A3_2406) | - | 2564191..2564406 (-) | 216 | WP_013966431.1 | hypothetical protein | - |
| NIT79A3_RS11870 (Nit79A3_2407) | - | 2564480..2564902 (-) | 423 | WP_013966432.1 | hypothetical protein | - |
| NIT79A3_RS11875 (Nit79A3_2408) | - | 2564973..2566286 (-) | 1314 | WP_198009353.1 | phage major capsid protein | - |
| NIT79A3_RS11880 (Nit79A3_2409) | - | 2566362..2567060 (-) | 699 | WP_013966434.1 | HK97 family phage prohead protease | - |
| NIT79A3_RS11885 (Nit79A3_2410) | - | 2567053..2568207 (-) | 1155 | WP_198009354.1 | phage portal protein | - |
| NIT79A3_RS11890 (Nit79A3_2411) | - | 2568366..2570090 (-) | 1725 | WP_013966436.1 | terminase TerL endonuclease subunit | - |
| NIT79A3_RS11895 (Nit79A3_2412) | - | 2570075..2570593 (-) | 519 | WP_013966437.1 | phage terminase small subunit P27 family | - |
| NIT79A3_RS11905 (Nit79A3_2414) | - | 2571237..2571740 (-) | 504 | WP_198009355.1 | hypothetical protein | - |
| NIT79A3_RS11910 (Nit79A3_2415) | - | 2571676..2571882 (-) | 207 | WP_013966440.1 | hypothetical protein | - |
| NIT79A3_RS11915 (Nit79A3_2416) | - | 2571872..2572099 (-) | 228 | WP_013966441.1 | hypothetical protein | - |
| NIT79A3_RS11920 | - | 2572092..2572397 (-) | 306 | WP_041360334.1 | hypothetical protein | - |
| NIT79A3_RS17915 (Nit79A3_2417) | - | 2572381..2574750 (-) | 2370 | WP_013966442.1 | VapE domain-containing protein | - |
| NIT79A3_RS11930 (Nit79A3_2418) | - | 2574754..2575134 (-) | 381 | WP_013966443.1 | hypothetical protein | - |
| NIT79A3_RS11935 (Nit79A3_2419) | - | 2575134..2575463 (-) | 330 | WP_013966444.1 | hypothetical protein | - |
| NIT79A3_RS11940 (Nit79A3_2421) | - | 2575566..2576036 (-) | 471 | WP_013966446.1 | phage regulatory CII family protein | - |
| NIT79A3_RS18810 | - | 2576304..2576585 (-) | 282 | WP_156797077.1 | hypothetical protein | - |
| NIT79A3_RS11950 (Nit79A3_2423) | - | 2576736..2577026 (-) | 291 | WP_013966448.1 | Cro/CI family transcriptional regulator | - |
| NIT79A3_RS17920 (Nit79A3_2424) | - | 2577124..2577504 (+) | 381 | WP_013966449.1 | helix-turn-helix domain-containing protein | - |
| NIT79A3_RS11960 (Nit79A3_2425) | - | 2577573..2577989 (+) | 417 | WP_013966450.1 | thermonuclease family protein | - |
| NIT79A3_RS11970 (Nit79A3_2426) | - | 2578406..2579275 (+) | 870 | WP_013966451.1 | hypothetical protein | - |
| NIT79A3_RS11980 (Nit79A3_2427) | - | 2579803..2580321 (-) | 519 | WP_013966452.1 | hypothetical protein | - |
| NIT79A3_RS11985 (Nit79A3_2428) | - | 2580387..2580659 (+) | 273 | WP_013966453.1 | hypothetical protein | - |
| NIT79A3_RS11990 (Nit79A3_2429) | - | 2580951..2581250 (+) | 300 | WP_013966454.1 | hypothetical protein | - |
| NIT79A3_RS11995 (Nit79A3_2430) | - | 2581312..2581653 (+) | 342 | WP_013966455.1 | hypothetical protein | - |
| NIT79A3_RS12000 (Nit79A3_2431) | - | 2581656..2582510 (+) | 855 | WP_013966456.1 | DUF2303 family protein | - |
| NIT79A3_RS12005 (Nit79A3_2432) | - | 2582553..2583140 (+) | 588 | WP_013966457.1 | hypothetical protein | - |
| NIT79A3_RS12010 (Nit79A3_2433) | - | 2583137..2583319 (+) | 183 | WP_013966458.1 | hypothetical protein | - |
| NIT79A3_RS17925 (Nit79A3_2434) | - | 2583336..2584316 (+) | 981 | WP_013966459.1 | hypothetical protein | - |
| NIT79A3_RS12020 (Nit79A3_2435) | - | 2584586..2584765 (+) | 180 | WP_013966460.1 | hypothetical protein | - |
| NIT79A3_RS17930 (Nit79A3_2436) | - | 2585055..2586047 (+) | 993 | WP_198009356.1 | antA/AntB antirepressor family protein | - |
| NIT79A3_RS12030 | - | 2586126..2586620 (+) | 495 | WP_041360340.1 | hypothetical protein | - |
| NIT79A3_RS12035 (Nit79A3_2438) | - | 2586628..2586885 (+) | 258 | WP_013966463.1 | hypothetical protein | - |
| NIT79A3_RS12040 (Nit79A3_2439) | ssb | 2586885..2587331 (+) | 447 | WP_013966464.1 | single-stranded DNA-binding protein | Machinery gene |
| NIT79A3_RS12045 (Nit79A3_2440) | - | 2587374..2587589 (+) | 216 | WP_013966465.1 | DUF4224 domain-containing protein | - |
| NIT79A3_RS12050 (Nit79A3_2441) | - | 2587628..2588593 (+) | 966 | WP_198009358.1 | tyrosine-type recombinase/integrase | - |
| NIT79A3_RS12055 (Nit79A3_2442) | - | 2588650..2589510 (-) | 861 | WP_198009359.1 | SPFH domain-containing protein | - |
| NIT79A3_RS12060 (Nit79A3_2443) | - | 2589733..2591013 (-) | 1281 | WP_013966468.1 | hypothetical protein | - |
| NIT79A3_RS12065 (Nit79A3_2444) | - | 2591239..2593473 (-) | 2235 | WP_013966469.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16597.41 Da Isoelectric Point: 5.0571
>NTDB_id=41654 NIT79A3_RS12040 WP_013966464.1 2586885..2587331(+) (ssb) [Nitrosomonas sp. Is79A3]
MASVNKVILIGNLGKDPETRYMSNGDAVTNITLATTDTWKDKNGEKQEKTEWHRVTFYRKLAEIAGEYLKKGRPVYIEGR
LETRKWTDKDGVERYTTDIIANDMKMLGNRQSGNTDESEQQNKTTPSAARAGAGNAGGFDDMDDDIPF
MASVNKVILIGNLGKDPETRYMSNGDAVTNITLATTDTWKDKNGEKQEKTEWHRVTFYRKLAEIAGEYLKKGRPVYIEGR
LETRKWTDKDGVERYTTDIIANDMKMLGNRQSGNTDESEQQNKTTPSAARAGAGNAGGFDDMDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=41654 NIT79A3_RS12040 WP_013966464.1 2586885..2587331(+) (ssb) [Nitrosomonas sp. Is79A3]
ATGGCATCAGTTAATAAAGTAATACTCATAGGCAACTTGGGGAAAGACCCGGAAACCCGTTACATGTCAAACGGCGATGC
TGTAACCAACATCACTTTGGCTACAACGGACACCTGGAAAGACAAGAATGGCGAGAAACAGGAAAAGACAGAATGGCATC
GCGTAACTTTTTATCGCAAGCTAGCGGAAATTGCCGGTGAATACCTAAAGAAAGGCAGACCGGTATATATTGAGGGGAGA
CTTGAAACTAGGAAATGGACTGATAAAGATGGCGTGGAACGCTACACCACAGACATCATTGCAAATGATATGAAGATGCT
GGGCAACAGACAGTCCGGAAATACTGATGAATCAGAGCAGCAGAACAAAACCACCCCATCAGCAGCTCGCGCAGGCGCGG
GGAATGCTGGCGGGTTTGATGATATGGATGATGATATCCCATTTTAG
ATGGCATCAGTTAATAAAGTAATACTCATAGGCAACTTGGGGAAAGACCCGGAAACCCGTTACATGTCAAACGGCGATGC
TGTAACCAACATCACTTTGGCTACAACGGACACCTGGAAAGACAAGAATGGCGAGAAACAGGAAAAGACAGAATGGCATC
GCGTAACTTTTTATCGCAAGCTAGCGGAAATTGCCGGTGAATACCTAAAGAAAGGCAGACCGGTATATATTGAGGGGAGA
CTTGAAACTAGGAAATGGACTGATAAAGATGGCGTGGAACGCTACACCACAGACATCATTGCAAATGATATGAAGATGCT
GGGCAACAGACAGTCCGGAAATACTGATGAATCAGAGCAGCAGAACAAAACCACCCCATCAGCAGCTCGCGCAGGCGCGG
GGAATGCTGGCGGGTTTGATGATATGGATGATGATATCCCATTTTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
49.438 |
100 |
0.595 |
| ssb | Neisseria meningitidis MC58 |
48.555 |
100 |
0.568 |
| ssb | Neisseria gonorrhoeae MS11 |
47.977 |
100 |
0.561 |
| ssb | Glaesserella parasuis strain SC1401 |
43.889 |
100 |
0.534 |