Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   H7798_RS00600 Genome accession   NZ_CP060638
Coordinates   98293..98577 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain TSPY141     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 93293..103577
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H7798_RS00575 (H7798_00580) - 95239..95604 (+) 366 WP_030126461.1 DUF1033 family protein -
  H7798_RS00580 (H7798_00585) comGA 95697..96635 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  H7798_RS00585 (H7798_00590) comGB 96571..97605 (+) 1035 WP_227875237.1 competence type IV pilus assembly protein ComGB Machinery gene
  H7798_RS00590 (H7798_00595) comGC 97607..97933 (+) 327 WP_011528161.1 competence type IV pilus major pilin ComGC Machinery gene
  H7798_RS00595 (H7798_00600) comGD 97908..98336 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  H7798_RS00600 (H7798_00605) comGE 98293..98577 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  H7798_RS00605 (H7798_00610) comGF 98570..99004 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  H7798_RS00610 (H7798_00615) comGG 98988..99314 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  H7798_RS00615 (H7798_00620) comGH 99412..100365 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  H7798_RS00620 (H7798_00625) - 100424..101620 (+) 1197 WP_030126459.1 acetate kinase -
  H7798_RS00625 (H7798_00630) - 101806..102114 (+) 309 WP_030126458.1 hypothetical protein -
  H7798_RS00630 (H7798_00635) proC 102197..102967 (-) 771 WP_023078993.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=415469 H7798_RS00600 WP_002987779.1 98293..98577(+) (comGE) [Streptococcus pyogenes strain TSPY141]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=415469 H7798_RS00600 WP_002987779.1 98293..98577(+) (comGE) [Streptococcus pyogenes strain TSPY141]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment