Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | GQY29_RS10550 | Genome accession | NZ_CP047191 |
| Coordinates | 285057..285266 (-) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain EU01 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 280057..290266
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GQY29_RS01425 (GQY29_01425) | - | 281054..281365 (-) | 312 | WP_002886559.1 | urease subunit beta | - |
| GQY29_RS01430 (GQY29_01430) | - | 281377..281679 (-) | 303 | WP_002886558.1 | urease subunit gamma | - |
| GQY29_RS01435 (GQY29_01435) | - | 281704..282219 (-) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| GQY29_RS10530 | - | 282625..282996 (+) | 372 | WP_224103195.1 | hypothetical protein | - |
| GQY29_RS10535 | - | 283220..283522 (+) | 303 | WP_224103194.1 | hypothetical protein | - |
| GQY29_RS10540 | - | 283763..284047 (+) | 285 | WP_232557103.1 | hypothetical protein | - |
| GQY29_RS10545 | - | 284015..284203 (-) | 189 | WP_224103239.1 | hypothetical protein | - |
| GQY29_RS01450 (GQY29_01450) | - | 284434..285002 (-) | 569 | Protein_281 | ATP-binding cassette domain-containing protein | - |
| GQY29_RS10550 (GQY29_01460) | comA | 285057..285266 (-) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| GQY29_RS10260 | comA | 285609..285899 (-) | 291 | WP_194238295.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| GQY29_RS10265 | - | 285884..286528 (-) | 645 | Protein_284 | cysteine peptidase family C39 domain-containing protein | - |
| GQY29_RS01470 (GQY29_01470) | comR | 286703..287602 (-) | 900 | WP_011680720.1 | helix-turn-helix domain-containing protein | Regulator |
| GQY29_RS01475 (GQY29_01475) | - | 287797..288447 (-) | 651 | WP_071417477.1 | phosphatase PAP2 family protein | - |
| GQY29_RS01480 (GQY29_01480) | - | 288450..289007 (-) | 558 | WP_071417478.1 | ECF transporter S component | - |
| GQY29_RS01485 (GQY29_01485) | - | 289318..289827 (-) | 510 | WP_024704182.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=411422 GQY29_RS10550 WP_002946147.1 285057..285266(-) (comA) [Streptococcus thermophilus strain EU01]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=411422 GQY29_RS10550 WP_002946147.1 285057..285266(-) (comA) [Streptococcus thermophilus strain EU01]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |