Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | GL187_RS10910 | Genome accession | NZ_CP046379 |
| Coordinates | 2134572..2134697 (-) | Length | 41 a.a. |
| NCBI ID | WP_197097936.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 563 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2129572..2139697
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GL187_RS11520 | - | 2129910..2131513 (-) | 1604 | Protein_2127 | YhgE/Pip family protein | - |
| GL187_RS10885 (GL187_11020) | - | 2131692..2132234 (+) | 543 | WP_001158269.1 | TetR/AcrR family transcriptional regulator | - |
| GL187_RS10900 (GL187_11035) | comE | 2132477..2133229 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| GL187_RS10905 (GL187_11040) | comD/comD2 | 2133226..2134551 (-) | 1326 | WP_024477997.1 | competence system sensor histidine kinase ComD | Regulator |
| GL187_RS10910 (GL187_11045) | comC/comC2 | 2134572..2134697 (-) | 126 | WP_197097936.1 | competence-stimulating peptide ComC | Regulator |
| GL187_RS10920 (GL187_11055) | rlmH | 2134979..2135458 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| GL187_RS10925 (GL187_11060) | htrA | 2135641..2136822 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| GL187_RS10930 (GL187_11065) | spo0J | 2136880..2137638 (+) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| GL187_RS10935 (GL187_11070) | dnaA | 2137851..2139212 (+) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4902.97 Da Isoelectric Point: 10.9061
>NTDB_id=403728 GL187_RS10910 WP_197097936.1 2134572..2134697(-) (comC/comC2) [Streptococcus pneumoniae strain 563]
MKNTVKLEQFVALKEKDLQNIKGGEMRIPRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQNIKGGEMRIPRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=403728 GL187_RS10910 WP_197097936.1 2134572..2134697(-) (comC/comC2) [Streptococcus pneumoniae strain 563]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTCCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTCCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
95.122 |
100 |
0.951 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
95.122 |
100 |
0.951 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae R6 |
75.61 |
100 |
0.756 |
| comC/comC1 | Streptococcus pneumoniae G54 |
75.61 |
100 |
0.756 |
| comC/comC1 | Streptococcus pneumoniae D39 |
75.61 |
100 |
0.756 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |