Detailed information
Overview
| Name | comW | Type | Regulator |
| Locus tag | GL183_RS11115 | Genome accession | NZ_CP046355 |
| Coordinates | 2160585..2160821 (-) | Length | 78 a.a. |
| NCBI ID | WP_000939544.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 475 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2140778..2170815 | 2160585..2160821 | within | 0 |
| IScluster/Tn | 2161138..2162765 | 2160585..2160821 | flank | 317 |
Gene organization within MGE regions
Location: 2140778..2170815
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GL183_RS10965 (GL183_11100) | - | 2140778..2141788 (+) | 1011 | WP_000009171.1 | YeiH family protein | - |
| GL183_RS11590 | - | 2141807..2142202 (-) | 396 | WP_061826320.1 | hypothetical protein | - |
| GL183_RS10975 (GL183_11110) | - | 2142243..2142680 (-) | 438 | WP_061633093.1 | CoA-binding protein | - |
| GL183_RS10980 (GL183_11115) | polA | 2142765..2145398 (-) | 2634 | WP_088834530.1 | DNA polymerase I | - |
| GL183_RS11220 | - | 2145654..2146561 (+) | 908 | Protein_2155 | Rpn family recombination-promoting nuclease/putative transposase | - |
| GL183_RS11000 (GL183_11135) | - | 2146688..2146969 (+) | 282 | Protein_2156 | ISL3 family transposase | - |
| GL183_RS11005 (GL183_11140) | - | 2147103..2148071 (-) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| GL183_RS11010 (GL183_11145) | - | 2148216..2149030 (-) | 815 | Protein_2158 | PrsW family glutamic-type intramembrane protease | - |
| GL183_RS11020 (GL183_11150) | - | 2149055..2149552 (-) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| GL183_RS11025 (GL183_11155) | radA | 2149625..2150986 (-) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| GL183_RS11030 (GL183_11160) | - | 2151000..2151515 (-) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| GL183_RS11035 (GL183_11165) | - | 2151517..2151960 (-) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| GL183_RS11040 | - | 2152265..2152414 (+) | 150 | WP_001030863.1 | hypothetical protein | - |
| GL183_RS11045 (GL183_11170) | - | 2152556..2152735 (+) | 180 | WP_001209433.1 | hypothetical protein | - |
| GL183_RS11050 (GL183_11175) | - | 2152955..2153320 (-) | 366 | Protein_2165 | autolysin | - |
| GL183_RS11055 (GL183_11180) | - | 2153340..2153507 (+) | 168 | WP_000024181.1 | YjzC family protein | - |
| GL183_RS11060 (GL183_11185) | - | 2153662..2153865 (-) | 204 | WP_001247549.1 | hypothetical protein | - |
| GL183_RS11065 (GL183_11190) | - | 2153888..2154079 (-) | 192 | WP_001112859.1 | DNA-binding protein | - |
| GL183_RS11070 (GL183_11195) | - | 2154651..2155019 (+) | 369 | WP_000464160.1 | helix-turn-helix transcriptional regulator | - |
| GL183_RS11075 (GL183_11200) | - | 2155019..2155252 (+) | 234 | WP_000156419.1 | hypothetical protein | - |
| GL183_RS11080 (GL183_11205) | - | 2155252..2155515 (+) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| GL183_RS11085 (GL183_11210) | - | 2155528..2155908 (+) | 381 | WP_000170931.1 | ImmA/IrrE family metallo-endopeptidase | - |
| GL183_RS11090 (GL183_11215) | - | 2155925..2156995 (+) | 1071 | WP_000401841.1 | type I restriction endonuclease | - |
| GL183_RS11595 (GL183_11220) | - | 2157056..2157403 (+) | 348 | WP_001839379.1 | hypothetical protein | - |
| GL183_RS11600 (GL183_11225) | - | 2157493..2158191 (+) | 699 | WP_001106362.1 | site-specific integrase | - |
| GL183_RS11105 (GL183_11235) | tadA | 2158400..2158867 (-) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| GL183_RS11110 (GL183_11240) | - | 2159068..2160354 (-) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| GL183_RS11115 (GL183_11245) | comW | 2160585..2160821 (-) | 237 | WP_000939544.1 | sigma(X)-activator ComW | Regulator |
| GL183_RS11120 (GL183_11250) | - | 2161087..2161884 (+) | 798 | Protein_2179 | transposase | - |
| GL183_RS11125 (GL183_11255) | - | 2161919..2162765 (-) | 847 | Protein_2180 | IS630 family transposase | - |
| GL183_RS11160 (GL183_11290) | comX/comX2 | 2168256..2168735 (-) | 480 | WP_000588925.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| GL183_RS11165 (GL183_11295) | ftsH | 2168857..2170815 (-) | 1959 | WP_000744557.1 | ATP-dependent zinc metalloprotease FtsH | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9667.10 Da Isoelectric Point: 6.4701
>NTDB_id=403069 GL183_RS11115 WP_000939544.1 2160585..2160821(-) (comW) [Streptococcus pneumoniae strain 475]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=403069 GL183_RS11115 WP_000939544.1 2160585..2160821(-) (comW) [Streptococcus pneumoniae strain 475]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae D39 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae R6 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae TIGR4 |
97.436 |
100 |
0.974 |
| comW | Streptococcus mitis SK321 |
78.205 |
100 |
0.782 |
| comW | Streptococcus mitis NCTC 12261 |
77.922 |
98.718 |
0.769 |