Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | GLO74_RS00020 | Genome accession | NZ_CP046354 |
| Coordinates | 1385..1510 (+) | Length | 41 a.a. |
| NCBI ID | WP_000799694.1 | Uniprot ID | Q9WW44 |
| Organism | Streptococcus pneumoniae strain 310 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1..6510
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GLO74_RS00010 (GLO74_00010) | rlmH | 624..1103 (+) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| GLO74_RS00020 (GLO74_00020) | comC/comC2 | 1385..1510 (+) | 126 | WP_000799694.1 | competence-stimulating peptide ComC | Regulator |
| GLO74_RS00025 (GLO74_00025) | comD/comD2 | 1531..2856 (+) | 1326 | WP_024477997.1 | competence system sensor histidine kinase ComD | Regulator |
| GLO74_RS00030 (GLO74_00030) | comE | 2853..3605 (+) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| GLO74_RS00045 (GLO74_00045) | - | 3848..4390 (-) | 543 | WP_001158269.1 | TetR/AcrR family transcriptional regulator | - |
| GLO74_RS11365 | - | 4569..6172 (+) | 1604 | Protein_6 | YhgE/Pip family protein | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4892.93 Da Isoelectric Point: 10.9061
>NTDB_id=402917 GLO74_RS00020 WP_000799694.1 1385..1510(+) (comC/comC2) [Streptococcus pneumoniae strain 310]
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=402917 GLO74_RS00020 WP_000799694.1 1385..1510(+) (comC/comC2) [Streptococcus pneumoniae strain 310]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
97.561 |
100 |
0.976 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae R6 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae G54 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae D39 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |