Detailed information
Bioinformatically predicted
Overview
| Name | comC | Type | Regulator |
| Locus tag | FOB92_RS08905 | Genome accession | NZ_CP046335 |
| Coordinates | 1850604..1850726 (-) | Length | 40 a.a. |
| NCBI ID | WP_004238992.1 | Uniprot ID | O33675 |
| Organism | Streptococcus mitis strain FDAARGOS_684 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1845604..1855726
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOB92_RS08880 (FOB92_08880) | - | 1847732..1848274 (+) | 543 | WP_001158274.1 | TetR/AcrR family transcriptional regulator | - |
| FOB92_RS08895 (FOB92_08895) | comE | 1848517..1849269 (-) | 753 | WP_000866073.1 | competence system response regulator transcription factor ComE | Regulator |
| FOB92_RS08900 (FOB92_08900) | comD | 1849266..1850591 (-) | 1326 | WP_020902616.1 | competence system sensor histidine kinase ComD | Regulator |
| FOB92_RS08905 (FOB92_08905) | comC | 1850604..1850726 (-) | 123 | WP_004238992.1 | competence-stimulating peptide ComC | Regulator |
| FOB92_RS08915 (FOB92_08915) | rlmH | 1851009..1851488 (-) | 480 | WP_000695934.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| FOB92_RS08920 (FOB92_08920) | htrA | 1851671..1852852 (+) | 1182 | WP_000681587.1 | S1C family serine protease | Regulator |
| FOB92_RS08925 (FOB92_08925) | spo0J | 1852910..1853668 (+) | 759 | WP_000410370.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| FOB92_RS08930 (FOB92_08930) | dnaA | 1853881..1855242 (+) | 1362 | WP_000660620.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 40 a.a. Molecular weight: 4897.64 Da Isoelectric Point: 10.6104
>NTDB_id=402844 FOB92_RS08905 WP_004238992.1 1850604..1850726(-) (comC) [Streptococcus mitis strain FDAARGOS_684]
MKNTVNLDKFVELKEKDLQNIQGGEIRQTHNIFFNFFKRR
MKNTVNLDKFVELKEKDLQNIQGGEIRQTHNIFFNFFKRR
Nucleotide
Download Length: 123 bp
>NTDB_id=402844 FOB92_RS08905 WP_004238992.1 1850604..1850726(-) (comC) [Streptococcus mitis strain FDAARGOS_684]
ATGAAAAACACAGTTAATTTAGATAAGTTTGTAGAATTGAAGGAAAAAGACTTGCAAAATATTCAAGGTGGGGAGATAAG
GCAAACACATAATATTTTCTTTAATTTCTTTAAAAGAAGATAA
ATGAAAAACACAGTTAATTTAGATAAGTTTGTAGAATTGAAGGAAAAAGACTTGCAAAATATTCAAGGTGGGGAGATAAG
GCAAACACATAATATTTTCTTTAATTTCTTTAAAAGAAGATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis NCTC 12261 |
100 |
100 |
1 |
| comC | Streptococcus mitis SK321 |
66.667 |
90 |
0.6 |
| comC/comC2 | Streptococcus pneumoniae A66 |
57.5 |
100 |
0.575 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
57.5 |
100 |
0.575 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
74.074 |
67.5 |
0.5 |
| comC/comC1 | Streptococcus pneumoniae R6 |
74.074 |
67.5 |
0.5 |
| comC/comC1 | Streptococcus pneumoniae G54 |
74.074 |
67.5 |
0.5 |
| comC/comC1 | Streptococcus pneumoniae D39 |
74.074 |
67.5 |
0.5 |