Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   GII77_RS12960 Genome accession   NZ_CP045825
Coordinates   2510750..2511124 (-) Length   124 a.a.
NCBI ID   WP_015251714.1    Uniprot ID   -
Organism   Bacillus subtilis strain 75     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2505750..2516124
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII77_RS12920 (GII77_12920) yqhG 2506082..2506876 (+) 795 WP_003230200.1 YqhG family protein -
  GII77_RS12925 (GII77_12925) sinI 2507059..2507232 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII77_RS12930 (GII77_12930) sinR 2507266..2507601 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII77_RS12935 (GII77_12935) tasA 2507694..2508479 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  GII77_RS12940 (GII77_12940) sipW 2508543..2509115 (-) 573 WP_003246088.1 signal peptidase I SipW -
  GII77_RS12945 (GII77_12945) tapA 2509099..2509860 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  GII77_RS12950 (GII77_12950) yqzG 2510132..2510458 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII77_RS12955 (GII77_12955) spoIITA 2510500..2510679 (-) 180 WP_029726723.1 YqzE family protein -
  GII77_RS12960 (GII77_12960) comGG 2510750..2511124 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  GII77_RS12965 (GII77_12965) comGF 2511125..2511508 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  GII77_RS12970 (GII77_12970) comGE 2511534..2511881 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  GII77_RS12975 (GII77_12975) comGD 2511865..2512296 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  GII77_RS12980 (GII77_12980) comGC 2512286..2512582 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  GII77_RS12985 (GII77_12985) comGB 2512596..2513633 (-) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  GII77_RS12990 (GII77_12990) comGA 2513620..2514690 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII77_RS12995 (GII77_12995) - 2514903..2515100 (-) 198 WP_014480259.1 CBS domain-containing protein -
  GII77_RS13000 (GII77_13000) corA 2515102..2516055 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14540.73 Da        Isoelectric Point: 8.7849

>NTDB_id=398305 GII77_RS12960 WP_015251714.1 2510750..2511124(-) (comGG) [Bacillus subtilis strain 75]
MYRTRGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=398305 GII77_RS12960 WP_015251714.1 2510750..2511124(-) (comGG) [Bacillus subtilis strain 75]
ATGTACCGTACGAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATCGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968

Multiple sequence alignment