Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GII77_RS12925 Genome accession   NZ_CP045825
Coordinates   2507059..2507232 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain 75     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2502059..2512232
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII77_RS12910 (GII77_12910) gcvT 2502858..2503946 (-) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -
  GII77_RS12915 (GII77_12915) hepAA 2504388..2506061 (+) 1674 WP_004398544.1 SNF2-related protein -
  GII77_RS12920 (GII77_12920) yqhG 2506082..2506876 (+) 795 WP_003230200.1 YqhG family protein -
  GII77_RS12925 (GII77_12925) sinI 2507059..2507232 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII77_RS12930 (GII77_12930) sinR 2507266..2507601 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII77_RS12935 (GII77_12935) tasA 2507694..2508479 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  GII77_RS12940 (GII77_12940) sipW 2508543..2509115 (-) 573 WP_003246088.1 signal peptidase I SipW -
  GII77_RS12945 (GII77_12945) tapA 2509099..2509860 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  GII77_RS12950 (GII77_12950) yqzG 2510132..2510458 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII77_RS12955 (GII77_12955) spoIITA 2510500..2510679 (-) 180 WP_029726723.1 YqzE family protein -
  GII77_RS12960 (GII77_12960) comGG 2510750..2511124 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  GII77_RS12965 (GII77_12965) comGF 2511125..2511508 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  GII77_RS12970 (GII77_12970) comGE 2511534..2511881 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=398303 GII77_RS12925 WP_003230187.1 2507059..2507232(+) (sinI) [Bacillus subtilis strain 75]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=398303 GII77_RS12925 WP_003230187.1 2507059..2507232(+) (sinI) [Bacillus subtilis strain 75]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment