Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GII81_RS13450 Genome accession   NZ_CP045820
Coordinates   2585468..2585851 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain MB9_B1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2580468..2590851
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII81_RS13410 (GII81_13410) sinI 2581401..2581574 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII81_RS13415 (GII81_13415) sinR 2581608..2581943 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII81_RS13420 (GII81_13420) tasA 2582036..2582821 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII81_RS13425 (GII81_13425) sipW 2582885..2583457 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII81_RS13430 (GII81_13430) tapA 2583441..2584202 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII81_RS13435 (GII81_13435) yqzG 2584474..2584800 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII81_RS13440 (GII81_13440) spoIITA 2584842..2585021 (-) 180 WP_029726723.1 YqzE family protein -
  GII81_RS13445 (GII81_13445) comGG 2585093..2585467 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII81_RS13450 (GII81_13450) comGF 2585468..2585851 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII81_RS13455 (GII81_13455) comGE 2585877..2586224 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  GII81_RS13460 (GII81_13460) comGD 2586208..2586639 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  GII81_RS13465 (GII81_13465) comGC 2586629..2586925 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  GII81_RS13470 (GII81_13470) comGB 2586939..2587976 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  GII81_RS13475 (GII81_13475) comGA 2587963..2589033 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII81_RS13480 (GII81_13480) - 2589246..2589443 (-) 198 WP_029726717.1 hypothetical protein -
  GII81_RS13485 (GII81_13485) corA 2589445..2590398 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=397983 GII81_RS13450 WP_029726721.1 2585468..2585851(-) (comGF) [Bacillus subtilis strain MB9_B1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=397983 GII81_RS13450 WP_029726721.1 2585468..2585851(-) (comGF) [Bacillus subtilis strain MB9_B1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment