Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GII81_RS13410 Genome accession   NZ_CP045820
Coordinates   2581401..2581574 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain MB9_B1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2576401..2586574
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII81_RS13395 (GII81_13395) gcvT 2577201..2578289 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  GII81_RS13400 (GII81_13400) hepAA 2578730..2580403 (+) 1674 WP_029726726.1 SNF2-related protein -
  GII81_RS13405 (GII81_13405) yqhG 2580424..2581218 (+) 795 WP_015714249.1 YqhG family protein -
  GII81_RS13410 (GII81_13410) sinI 2581401..2581574 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII81_RS13415 (GII81_13415) sinR 2581608..2581943 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII81_RS13420 (GII81_13420) tasA 2582036..2582821 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII81_RS13425 (GII81_13425) sipW 2582885..2583457 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII81_RS13430 (GII81_13430) tapA 2583441..2584202 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII81_RS13435 (GII81_13435) yqzG 2584474..2584800 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII81_RS13440 (GII81_13440) spoIITA 2584842..2585021 (-) 180 WP_029726723.1 YqzE family protein -
  GII81_RS13445 (GII81_13445) comGG 2585093..2585467 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII81_RS13450 (GII81_13450) comGF 2585468..2585851 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII81_RS13455 (GII81_13455) comGE 2585877..2586224 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=397980 GII81_RS13410 WP_003230187.1 2581401..2581574(+) (sinI) [Bacillus subtilis strain MB9_B1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=397980 GII81_RS13410 WP_003230187.1 2581401..2581574(+) (sinI) [Bacillus subtilis strain MB9_B1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment