Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE/blpR   Type   Regulator
Locus tag   GFB63_RS05385 Genome accession   NZ_CP045596
Coordinates   1040169..1040909 (+) Length   246 a.a.
NCBI ID   WP_193838172.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain TK-P3A     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1007597..1087001 1040169..1040909 within 0


Gene organization within MGE regions


Location: 1007597..1087001
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GFB63_RS05270 (GFB63_05415) - 1011724..1011915 (+) 192 WP_100262165.1 calcium-binding protein -
  GFB63_RS05275 (GFB63_05420) - 1011899..1012450 (+) 552 WP_193838168.1 hypothetical protein -
  GFB63_RS05280 (GFB63_05425) - 1012500..1017950 (+) 5451 Protein_997 DEAD/DEAH box helicase family protein -
  GFB63_RS05285 (GFB63_05435) - 1018460..1020238 (+) 1779 WP_111679146.1 reverse transcriptase/maturase family protein -
  GFB63_RS05290 (GFB63_05440) - 1020331..1021719 (+) 1389 Protein_999 helicase-related protein -
  GFB63_RS05295 (GFB63_05445) - 1021790..1022089 (+) 300 WP_111679148.1 DUF5962 family protein -
  GFB63_RS05300 (GFB63_05450) - 1022103..1022393 (+) 291 WP_111679150.1 DUF5966 family protein -
  GFB63_RS05305 (GFB63_05455) - 1022687..1024309 (+) 1623 WP_111679152.1 AAA family ATPase -
  GFB63_RS05310 (GFB63_05460) - 1024306..1025634 (+) 1329 WP_111679154.1 HNH endonuclease signature motif containing protein -
  GFB63_RS05315 (GFB63_05465) - 1025897..1026535 (+) 639 WP_111679156.1 peptidylprolyl isomerase -
  GFB63_RS05320 (GFB63_05470) - 1026575..1027651 (+) 1077 WP_193838170.1 toprim domain-containing protein -
  GFB63_RS05325 (GFB63_05475) - 1027705..1027932 (+) 228 WP_111679158.1 DUF5965 family protein -
  GFB63_RS05330 (GFB63_05480) - 1027929..1028318 (+) 390 WP_039670295.1 DUF5945 family protein -
  GFB63_RS05335 (GFB63_05485) - 1028365..1028655 (+) 291 WP_162173398.1 hypothetical protein -
  GFB63_RS05340 (GFB63_05490) - 1028791..1030129 (+) 1339 Protein_1009 IS1182 family transposase -
  GFB63_RS10555 pezA 1030312..1030788 (+) 477 WP_039670297.1 type II toxin-antitoxin system antitoxin PezA -
  GFB63_RS05345 (GFB63_05495) pezT 1030788..1031564 (+) 777 WP_111679164.1 type II toxin-antitoxin system toxin PezT -
  GFB63_RS05350 (GFB63_05500) - 1031548..1032357 (+) 810 WP_039670299.1 Hachiman antiphage defense system protein HamA -
  GFB63_RS05355 (GFB63_05505) - 1032354..1035437 (+) 3084 WP_111679166.1 DEAD/DEAH box helicase -
  GFB63_RS05360 (GFB63_05510) - 1035462..1036358 (+) 897 WP_193838435.1 restriction endonuclease -
  GFB63_RS05365 (GFB63_05515) - 1036699..1037061 (+) 363 WP_039671040.1 SAG1252 family conjugative relaxosome accessory protein -
  GFB63_RS05370 (GFB63_05520) - 1037064..1037429 (+) 366 WP_039671039.1 plasmid mobilization protein -
  GFB63_RS05375 (GFB63_05525) - 1037416..1039299 (+) 1884 WP_193838171.1 SAG1250 family conjugative relaxase -
  GFB63_RS05380 (GFB63_05535) - 1039826..1040167 (+) 342 WP_024404826.1 LytTR family DNA-binding domain-containing protein -
  GFB63_RS05385 (GFB63_05540) comE/blpR 1040169..1040909 (+) 741 WP_193838172.1 response regulator transcription factor Regulator
  GFB63_RS05390 (GFB63_05545) - 1040920..1042260 (+) 1341 WP_193838173.1 sensor histidine kinase -
  GFB63_RS05395 (GFB63_05550) - 1042308..1042463 (-) 156 WP_096811960.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  GFB63_RS05400 (GFB63_05555) - 1042562..1043923 (-) 1362 WP_193838174.1 bacteriocin secretion accessory protein -
  GFB63_RS05405 (GFB63_05560) comA/nlmT 1043935..1046088 (-) 2154 WP_193838175.1 peptide cleavage/export ABC transporter Regulator
  GFB63_RS05410 (GFB63_05565) - 1046386..1046643 (+) 258 WP_039671027.1 Blp family class II bacteriocin -
  GFB63_RS05415 (GFB63_05570) - 1046660..1046854 (+) 195 WP_039671026.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  GFB63_RS05420 (GFB63_05575) - 1047456..1048806 (+) 1351 Protein_1026 IS3 family transposase -
  GFB63_RS05425 (GFB63_05580) - 1049230..1050255 (+) 1026 WP_193838176.1 thioredoxin fold domain-containing protein -
  GFB63_RS05430 (GFB63_05585) - 1050259..1050954 (+) 696 WP_111679181.1 CPBP family intramembrane glutamic endopeptidase -
  GFB63_RS05435 - 1050984..1051136 (+) 153 WP_162173399.1 hypothetical protein -
  GFB63_RS05440 (GFB63_05590) - 1051322..1051717 (+) 396 WP_111679183.1 sigma-70 family RNA polymerase sigma factor -
  GFB63_RS05445 (GFB63_05595) - 1052035..1052175 (+) 141 WP_044775899.1 hypothetical protein -
  GFB63_RS05450 (GFB63_05600) - 1052274..1053848 (+) 1575 WP_111679185.1 recombinase family protein -
  GFB63_RS05455 (GFB63_05605) - 1053848..1055467 (+) 1620 WP_111679187.1 recombinase family protein -
  GFB63_RS05460 (GFB63_05610) - 1055460..1056899 (+) 1440 WP_133264091.1 recombinase family protein -
  GFB63_RS05465 (GFB63_05615) - 1057010..1057321 (+) 312 Protein_1035 NUDIX domain-containing protein -
  GFB63_RS05470 (GFB63_05620) prmA 1057321..1058274 (+) 954 WP_084828438.1 50S ribosomal protein L11 methyltransferase -
  GFB63_RS05475 (GFB63_05625) - 1058275..1059018 (+) 744 WP_084825734.1 16S rRNA (uracil(1498)-N(3))-methyltransferase -
  GFB63_RS05480 (GFB63_05630) - 1059202..1061778 (+) 2577 Protein_1038 bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase -
  GFB63_RS05485 (GFB63_05635) nrdI 1061765..1062223 (-) 459 WP_084828439.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -
  GFB63_RS05490 (GFB63_05640) - 1062392..1064611 (+) 2220 WP_084828440.1 bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase -
  GFB63_RS05495 (GFB63_05645) dtd 1064624..1065067 (+) 444 WP_084828441.1 D-aminoacyl-tRNA deacylase -
  GFB63_RS10915 (GFB63_05650) - 1065508..1065792 (+) 285 WP_065972829.1 glycoside hydrolase family 66 protein -
  GFB63_RS10920 - 1065722..1065970 (+) 249 Protein_1043 glycoside hydrolase family 66 protein -
  GFB63_RS10565 - 1066057..1066236 (+) 180 WP_223899617.1 hypothetical protein -
  GFB63_RS10570 - 1066432..1066650 (+) 219 WP_223899612.1 hypothetical protein -
  GFB63_RS10575 - 1066669..1067043 (+) 375 WP_223899613.1 hypothetical protein -
  GFB63_RS05515 (GFB63_05665) ilvA 1067344..1068594 (+) 1251 WP_084828442.1 threonine ammonia-lyase IlvA -
  GFB63_RS05520 (GFB63_05670) def 1068755..1069369 (-) 615 WP_002949244.1 peptide deformylase -
  GFB63_RS05525 (GFB63_05675) - 1069463..1070101 (-) 639 WP_100273462.1 cyclic nucleotide-binding domain-containing protein -
  GFB63_RS05530 (GFB63_05680) - 1070208..1071371 (+) 1164 WP_100273463.1 MFS transporter -
  GFB63_RS05535 (GFB63_05685) rpsO 1071520..1071789 (+) 270 WP_002949247.1 30S ribosomal protein S15 -
  GFB63_RS05540 (GFB63_05690) - 1072019..1072600 (-) 582 WP_011225359.1 VanZ family protein -
  GFB63_RS05545 - 1073169..1073339 (+) 171 WP_193838177.1 hypothetical protein -
  GFB63_RS05550 (GFB63_05695) - 1073426..1073533 (+) 108 WP_193838178.1 LPXTG cell wall anchor domain-containing protein -
  GFB63_RS05555 (GFB63_05700) - 1073621..1074361 (-) 741 WP_179972549.1 amino acid ABC transporter ATP-binding protein -
  GFB63_RS05560 (GFB63_05705) - 1074361..1075911 (-) 1551 WP_193838179.1 ABC transporter substrate-binding protein/permease -
  GFB63_RS05565 (GFB63_05710) - 1076114..1076968 (+) 855 WP_011680666.1 undecaprenyl-diphosphate phosphatase -
  GFB63_RS05570 (GFB63_05715) - 1077020..1077328 (-) 309 WP_306496352.1 DUF3021 family protein -
  GFB63_RS05575 (GFB63_05720) mecA 1077605..1078354 (+) 750 WP_011680667.1 adaptor protein MecA Regulator
  GFB63_RS05580 (GFB63_05725) - 1078358..1079515 (+) 1158 WP_014621088.1 glycosyltransferase family 4 protein -
  GFB63_RS05585 (GFB63_05730) sufC 1079676..1080446 (+) 771 WP_002947634.1 Fe-S cluster assembly ATPase SufC -
  GFB63_RS05590 (GFB63_05735) sufD 1080483..1081745 (+) 1263 WP_011680669.1 Fe-S cluster assembly protein SufD -
  GFB63_RS05595 (GFB63_05740) - 1081799..1083031 (+) 1233 WP_046206385.1 cysteine desulfurase -
  GFB63_RS05600 (GFB63_05745) sufU 1083018..1083452 (+) 435 WP_111679194.1 Fe-S cluster assembly sulfur transfer protein SufU -
  GFB63_RS05605 (GFB63_05750) sufB 1083532..1084950 (+) 1419 WP_002947647.1 Fe-S cluster assembly protein SufB -
  GFB63_RS05610 (GFB63_05755) - 1085234..1086307 (+) 1074 Protein_1066 peptide ABC transporter substrate-binding protein -
  GFB63_RS05615 (GFB63_05760) - 1086315..1086533 (+) 219 Protein_1067 ABC transporter permease subunit -

Sequence


Protein


Download         Length: 246 a.a.        Molecular weight: 28836.05 Da        Isoelectric Point: 7.2201

>NTDB_id=395473 GFB63_RS05385 WP_193838172.1 1040169..1040909(+) (comE/blpR) [Streptococcus thermophilus strain TK-P3A]
MNIFVIEDDFMQQARIEKIITKLLEKHNIVPKKFEISGKPHQLLQAIEEKGVHQLFFLDIEIKEDELKGLQVAKQIREID
PYASIVFVTTHSEFMSLSFRYQVSALDYIDKELGVTEFESRIEAALLHTHNKDNSAVSDDSFYFKSKYAQVQYPFNEVYY
IETSPRPHRVILYTKTDRMEFTASLSDILKQDKRLVQCHRSFAINPRNVVKVDRNEKQIYFPNGATCFISRQKLESALAV
IDRLHR

Nucleotide


Download         Length: 741 bp        

>NTDB_id=395473 GFB63_RS05385 WP_193838172.1 1040169..1040909(+) (comE/blpR) [Streptococcus thermophilus strain TK-P3A]
ATGAATATCTTTGTAATAGAAGATGATTTTATGCAACAAGCGAGAATTGAGAAGATTATTACTAAGCTGTTAGAAAAGCA
CAACATCGTTCCGAAAAAATTTGAAATTTCAGGAAAACCTCATCAGCTACTTCAAGCAATAGAAGAAAAAGGAGTACATC
AGCTCTTCTTTTTAGATATTGAGATTAAGGAAGACGAACTAAAAGGACTTCAAGTCGCTAAACAAATTAGAGAGATTGAC
CCTTATGCTAGTATTGTTTTTGTGACAACACACTCCGAGTTTATGTCCTTATCTTTCAGGTACCAGGTATCTGCCTTGGA
CTATATTGACAAAGAGCTTGGAGTTACCGAATTTGAATCGCGAATAGAAGCAGCTTTACTTCATACTCACAATAAGGACA
ATAGCGCCGTATCGGATGATTCATTCTATTTTAAGTCCAAATATGCTCAAGTACAATACCCATTCAATGAAGTGTACTAC
ATCGAGACTTCTCCCCGCCCTCATCGTGTTATCCTTTATACCAAGACAGACCGAATGGAGTTCACAGCAAGTTTGTCAGA
CATTTTGAAACAAGATAAACGACTTGTACAATGTCATCGTTCGTTTGCAATCAATCCGAGGAATGTTGTTAAAGTGGATA
GAAATGAAAAACAGATCTACTTTCCTAATGGAGCCACCTGTTTTATTTCAAGGCAAAAGCTAGAATCAGCTTTAGCTGTT
ATTGATAGACTGCATAGATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

53.306

98.374

0.524

  comE/comE1 Streptococcus equinus JB1

41.423

97.154

0.402

  comE/comE2 Streptococcus equinus JB1

36.475

99.187

0.362


Multiple sequence alignment