Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   F3129_RS12210 Genome accession   NZ_CP044133
Coordinates   2522784..2523161 (-) Length   125 a.a.
NCBI ID   WP_150941311.1    Uniprot ID   -
Organism   Bacillus velezensis strain FJAT-46737     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2517784..2528161
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F3129_RS12170 (F3129_12170) - 2518282..2519076 (+) 795 WP_014418368.1 YqhG family protein -
  F3129_RS12175 (F3129_12175) sinI 2519253..2519426 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  F3129_RS12180 (F3129_12180) sinR 2519460..2519795 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  F3129_RS12185 (F3129_12185) tasA 2519843..2520628 (-) 786 WP_150941309.1 biofilm matrix protein TasA -
  F3129_RS12190 (F3129_12190) sipW 2520693..2521277 (-) 585 WP_015240205.1 signal peptidase I SipW -
  F3129_RS12195 (F3129_12195) tapA 2521249..2521920 (-) 672 WP_150941310.1 amyloid fiber anchoring/assembly protein TapA -
  F3129_RS12200 (F3129_12200) - 2522179..2522508 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  F3129_RS12205 (F3129_12205) - 2522548..2522727 (-) 180 WP_003153093.1 YqzE family protein -
  F3129_RS12210 (F3129_12210) comGG 2522784..2523161 (-) 378 WP_150941311.1 competence type IV pilus minor pilin ComGG Machinery gene
  F3129_RS12215 (F3129_12215) comGF 2523162..2523662 (-) 501 WP_256994853.1 competence type IV pilus minor pilin ComGF -
  F3129_RS12220 (F3129_12220) comGE 2523571..2523885 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  F3129_RS12225 (F3129_12225) comGD 2523869..2524306 (-) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene
  F3129_RS12230 (F3129_12230) comGC 2524296..2524604 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  F3129_RS12235 (F3129_12235) comGB 2524609..2525646 (-) 1038 WP_150941312.1 competence type IV pilus assembly protein ComGB Machinery gene
  F3129_RS12240 (F3129_12240) comGA 2525633..2526703 (-) 1071 WP_150941313.1 competence type IV pilus ATPase ComGA Machinery gene
  F3129_RS12245 (F3129_12245) - 2526896..2527846 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14070.03 Da        Isoelectric Point: 9.4095

>NTDB_id=388176 F3129_RS12210 WP_150941311.1 2522784..2523161(-) (comGG) [Bacillus velezensis strain FJAT-46737]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDCRETVQVTIQAETTTGTRRGAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=388176 F3129_RS12210 WP_150941311.1 2522784..2523161(-) (comGG) [Bacillus velezensis strain FJAT-46737]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACTGTTTCT
TTTCACATCACGGGGAGTGATTGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACCGGAACGAGACGGGG
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment