Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | F3129_RS12175 | Genome accession | NZ_CP044133 |
| Coordinates | 2519253..2519426 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain FJAT-46737 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2514253..2524426
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F3129_RS12160 (F3129_12160) | gcvT | 2515066..2516166 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| F3129_RS12165 (F3129_12165) | - | 2516590..2518260 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| F3129_RS12170 (F3129_12170) | - | 2518282..2519076 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| F3129_RS12175 (F3129_12175) | sinI | 2519253..2519426 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| F3129_RS12180 (F3129_12180) | sinR | 2519460..2519795 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| F3129_RS12185 (F3129_12185) | tasA | 2519843..2520628 (-) | 786 | WP_150941309.1 | biofilm matrix protein TasA | - |
| F3129_RS12190 (F3129_12190) | sipW | 2520693..2521277 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| F3129_RS12195 (F3129_12195) | tapA | 2521249..2521920 (-) | 672 | WP_150941310.1 | amyloid fiber anchoring/assembly protein TapA | - |
| F3129_RS12200 (F3129_12200) | - | 2522179..2522508 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| F3129_RS12205 (F3129_12205) | - | 2522548..2522727 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| F3129_RS12210 (F3129_12210) | comGG | 2522784..2523161 (-) | 378 | WP_150941311.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| F3129_RS12215 (F3129_12215) | comGF | 2523162..2523662 (-) | 501 | WP_256994853.1 | competence type IV pilus minor pilin ComGF | - |
| F3129_RS12220 (F3129_12220) | comGE | 2523571..2523885 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| F3129_RS12225 (F3129_12225) | comGD | 2523869..2524306 (-) | 438 | WP_015240210.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=388174 F3129_RS12175 WP_003153105.1 2519253..2519426(+) (sinI) [Bacillus velezensis strain FJAT-46737]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=388174 F3129_RS12175 WP_003153105.1 2519253..2519426(+) (sinI) [Bacillus velezensis strain FJAT-46737]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |