Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   F5K02_RS13155 Genome accession   NZ_CP044132
Coordinates   2683051..2683488 (-) Length   145 a.a.
NCBI ID   WP_094032243.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain ZKY01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2678051..2688488
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F5K02_RS13105 (F5K02_13175) sinI 2678435..2678608 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  F5K02_RS13110 (F5K02_13180) sinR 2678642..2678977 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  F5K02_RS13115 (F5K02_13185) - 2679025..2679810 (-) 786 WP_007408329.1 TasA family protein -
  F5K02_RS13120 (F5K02_13190) - 2679875..2680459 (-) 585 WP_015240205.1 signal peptidase I -
  F5K02_RS13125 (F5K02_13195) tapA 2680431..2681102 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  F5K02_RS13130 (F5K02_13200) - 2681361..2681690 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  F5K02_RS13135 (F5K02_13205) - 2681730..2681909 (-) 180 WP_003153093.1 YqzE family protein -
  F5K02_RS13140 (F5K02_13210) comGG 2681966..2682343 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  F5K02_RS13145 (F5K02_13215) comGF 2682344..2682844 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  F5K02_RS13150 (F5K02_13220) comGE 2682753..2683067 (-) 315 WP_094032244.1 competence type IV pilus minor pilin ComGE -
  F5K02_RS13155 (F5K02_13225) comGD 2683051..2683488 (-) 438 WP_094032243.1 competence type IV pilus minor pilin ComGD Machinery gene
  F5K02_RS13160 (F5K02_13230) comGC 2683478..2683786 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  F5K02_RS13165 (F5K02_13235) comGB 2683791..2684828 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  F5K02_RS13170 (F5K02_13240) comGA 2684815..2685885 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  F5K02_RS13175 (F5K02_13245) - 2686077..2687027 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  F5K02_RS13180 (F5K02_13250) - 2687173..2688474 (+) 1302 WP_241457553.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.72 Da        Isoelectric Point: 10.2172

>NTDB_id=388103 F5K02_RS13155 WP_094032243.1 2683051..2683488(-) (comGD) [Bacillus amyloliquefaciens strain ZKY01]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPACTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHRYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=388103 F5K02_RS13155 WP_094032243.1 2683051..2683488(-) (comGD) [Bacillus amyloliquefaciens strain ZKY01]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACAGTTTTGTTCACGACGGTTCCGCCGGCCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAGATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGTGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566


Multiple sequence alignment