Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | F5K02_RS13105 | Genome accession | NZ_CP044132 |
| Coordinates | 2678435..2678608 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain ZKY01 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2673435..2683608
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F5K02_RS13090 (F5K02_13160) | gcvT | 2674248..2675348 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| F5K02_RS13095 (F5K02_13165) | - | 2675772..2677442 (+) | 1671 | WP_031378948.1 | SNF2-related protein | - |
| F5K02_RS13100 (F5K02_13170) | - | 2677464..2678258 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| F5K02_RS13105 (F5K02_13175) | sinI | 2678435..2678608 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| F5K02_RS13110 (F5K02_13180) | sinR | 2678642..2678977 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| F5K02_RS13115 (F5K02_13185) | - | 2679025..2679810 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| F5K02_RS13120 (F5K02_13190) | - | 2679875..2680459 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| F5K02_RS13125 (F5K02_13195) | tapA | 2680431..2681102 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| F5K02_RS13130 (F5K02_13200) | - | 2681361..2681690 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| F5K02_RS13135 (F5K02_13205) | - | 2681730..2681909 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| F5K02_RS13140 (F5K02_13210) | comGG | 2681966..2682343 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| F5K02_RS13145 (F5K02_13215) | comGF | 2682344..2682844 (-) | 501 | WP_254922226.1 | competence type IV pilus minor pilin ComGF | - |
| F5K02_RS13150 (F5K02_13220) | comGE | 2682753..2683067 (-) | 315 | WP_094032244.1 | competence type IV pilus minor pilin ComGE | - |
| F5K02_RS13155 (F5K02_13225) | comGD | 2683051..2683488 (-) | 438 | WP_094032243.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=388100 F5K02_RS13105 WP_003153105.1 2678435..2678608(+) (sinI) [Bacillus amyloliquefaciens strain ZKY01]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=388100 F5K02_RS13105 WP_003153105.1 2678435..2678608(+) (sinI) [Bacillus amyloliquefaciens strain ZKY01]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |