Detailed information
Bioinformatically predicted
Overview
| Name | comYD | Type | Machinery gene |
| Locus tag | FOB77_RS03090 | Genome accession | NZ_CP044091 |
| Coordinates | 558142..558570 (-) | Length | 142 a.a. |
| NCBI ID | WP_000793381.1 | Uniprot ID | A0A8B4RCN7 |
| Organism | Streptococcus agalactiae strain FDAARGOS_669 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 511601..557281 | 558142..558570 | flank | 861 |
Gene organization within MGE regions
Location: 511601..558570
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOB77_RS02810 (FOB77_02810) | - | 511722..512012 (-) | 291 | WP_000158581.1 | DUF5962 family protein | - |
| FOB77_RS02815 (FOB77_02815) | - | 512023..512877 (-) | 855 | WP_000005759.1 | phage replisome organizer N-terminal domain-containing protein | - |
| FOB77_RS02820 (FOB77_02820) | - | 512889..513173 (-) | 285 | WP_001287945.1 | hypothetical protein | - |
| FOB77_RS02825 (FOB77_02825) | - | 513320..513838 (+) | 519 | WP_000181342.1 | helix-turn-helix domain-containing protein | - |
| FOB77_RS02830 (FOB77_02830) | - | 513893..515047 (+) | 1155 | WP_000110711.1 | site-specific integrase | - |
| FOB77_RS02835 (FOB77_02835) | rpsI | 515193..515585 (-) | 393 | WP_000035940.1 | 30S ribosomal protein S9 | - |
| FOB77_RS02840 (FOB77_02840) | rplM | 515606..516052 (-) | 447 | WP_001867156.1 | 50S ribosomal protein L13 | - |
| FOB77_RS02845 (FOB77_02845) | - | 516353..517519 (+) | 1167 | WP_000160598.1 | IS30-like element ISSag9 family transposase | - |
| FOB77_RS02850 (FOB77_02850) | - | 517837..517956 (-) | 120 | Protein_522 | helix-turn-helix transcriptional regulator | - |
| FOB77_RS02860 (FOB77_02860) | - | 518494..519354 (-) | 861 | WP_000143135.1 | DegV family protein | - |
| FOB77_RS02865 (FOB77_02865) | - | 519447..519965 (-) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| FOB77_RS02870 (FOB77_02870) | rlmB | 519962..520717 (-) | 756 | WP_000178023.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| FOB77_RS02875 (FOB77_02875) | - | 520820..521206 (-) | 387 | WP_000568029.1 | Mini-ribonuclease 3 | - |
| FOB77_RS02880 (FOB77_02880) | cysS | 521199..522542 (-) | 1344 | WP_000591129.1 | cysteine--tRNA ligase | - |
| FOB77_RS02885 (FOB77_02885) | - | 522539..522721 (-) | 183 | WP_000656477.1 | hypothetical protein | - |
| FOB77_RS02890 (FOB77_02890) | cysE | 522731..523315 (-) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| FOB77_RS02895 (FOB77_02895) | - | 523324..524076 (-) | 753 | WP_000204780.1 | SseB family protein | - |
| FOB77_RS02900 (FOB77_02900) | pnp | 524078..526207 (-) | 2130 | WP_000043857.1 | polyribonucleotide nucleotidyltransferase | - |
| FOB77_RS02905 (FOB77_02905) | rpsO | 526588..526857 (-) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| FOB77_RS02910 (FOB77_02910) | - | 526945..528204 (-) | 1260 | WP_001203074.1 | ferric reductase-like transmembrane domain-containing protein | - |
| FOB77_RS02915 (FOB77_02915) | - | 528313..529242 (-) | 930 | WP_001203828.1 | transketolase family protein | - |
| FOB77_RS02920 (FOB77_02920) | - | 529239..530096 (-) | 858 | WP_000203492.1 | transketolase | - |
| FOB77_RS02925 (FOB77_02925) | - | 530099..531454 (-) | 1356 | WP_000677351.1 | PTS ascorbate transporter subunit IIC | - |
| FOB77_RS02930 (FOB77_02930) | - | 531467..531751 (-) | 285 | WP_000944235.1 | PTS sugar transporter subunit IIB | - |
| FOB77_RS02935 (FOB77_02935) | - | 531754..533790 (-) | 2037 | WP_000228178.1 | BglG family transcription antiterminator | - |
| FOB77_RS02940 (FOB77_02940) | treC | 534010..535635 (-) | 1626 | WP_000151014.1 | alpha,alpha-phosphotrehalase | - |
| FOB77_RS02945 (FOB77_02945) | treP | 535857..537887 (-) | 2031 | WP_000434610.1 | PTS system trehalose-specific EIIBC component | - |
| FOB77_RS02950 (FOB77_02950) | - | 538169..538795 (-) | 627 | WP_000171304.1 | ABC transporter ATP-binding protein | - |
| FOB77_RS02955 (FOB77_02955) | - | 538779..539582 (-) | 804 | WP_000140979.1 | ABC transporter ATP-binding protein | - |
| FOB77_RS02960 (FOB77_02960) | - | 539594..540415 (-) | 822 | WP_000603397.1 | ABC transporter permease | - |
| FOB77_RS02965 (FOB77_02965) | - | 540412..541389 (-) | 978 | WP_000680644.1 | ABC transporter permease | - |
| FOB77_RS02970 (FOB77_02970) | - | 541502..543130 (-) | 1629 | WP_000170504.1 | ABC transporter substrate-binding protein | - |
| FOB77_RS02980 (FOB77_02980) | lrgB | 543373..544101 (-) | 729 | WP_000421727.1 | antiholin-like protein LrgB | - |
| FOB77_RS02985 (FOB77_02985) | - | 544103..544558 (-) | 456 | WP_000683316.1 | CidA/LrgA family protein | - |
| FOB77_RS02990 (FOB77_02990) | - | 544728..545468 (-) | 741 | WP_000697630.1 | LytTR family DNA-binding domain-containing protein | - |
| FOB77_RS02995 (FOB77_02995) | - | 545449..547194 (-) | 1746 | WP_000930334.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| FOB77_RS03000 (FOB77_03000) | - | 547221..547865 (-) | 645 | WP_000416612.1 | HAD family phosphatase | - |
| FOB77_RS03005 (FOB77_03005) | ssbA | 547988..548383 (-) | 396 | WP_000282450.1 | single-stranded DNA-binding protein | Machinery gene |
| FOB77_RS03010 (FOB77_03010) | - | 548464..549180 (+) | 717 | WP_000186183.1 | class I SAM-dependent methyltransferase | - |
| FOB77_RS03015 (FOB77_03015) | ytpR | 549234..549860 (-) | 627 | WP_000578331.1 | YtpR family tRNA-binding protein | - |
| FOB77_RS03020 (FOB77_03020) | - | 549893..550216 (-) | 324 | WP_000601792.1 | thioredoxin family protein | - |
| FOB77_RS03025 (FOB77_03025) | - | 550213..550497 (-) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| FOB77_RS03030 (FOB77_03030) | - | 550658..550897 (+) | 240 | WP_000660181.1 | hypothetical protein | - |
| FOB77_RS03035 (FOB77_03035) | pepA | 551082..552149 (+) | 1068 | WP_001281321.1 | glutamyl aminopeptidase | - |
| FOB77_RS03040 (FOB77_03040) | proC | 552219..552989 (+) | 771 | WP_001867096.1 | pyrroline-5-carboxylate reductase | - |
| FOB77_RS03045 (FOB77_03045) | - | 553010..553675 (-) | 666 | WP_000008111.1 | CPBP family intramembrane glutamic endopeptidase | - |
| FOB77_RS03050 (FOB77_03050) | - | 553744..554199 (-) | 456 | WP_000905674.1 | hypothetical protein | - |
| FOB77_RS03055 (FOB77_03055) | - | 554240..554377 (-) | 138 | WP_001867090.1 | hypothetical protein | - |
| FOB77_RS03060 (FOB77_03060) | - | 554436..554642 (-) | 207 | WP_000798242.1 | helix-turn-helix transcriptional regulator | - |
| FOB77_RS03065 (FOB77_03065) | - | 554793..555986 (-) | 1194 | WP_000047535.1 | acetate kinase | - |
| FOB77_RS03070 (FOB77_03070) | comYH | 556018..556992 (-) | 975 | WP_001008570.1 | class I SAM-dependent methyltransferase | Machinery gene |
| FOB77_RS03075 (FOB77_03075) | comGG | 557107..557478 (-) | 372 | WP_000601104.1 | competence type IV pilus minor pilin ComGG | - |
| FOB77_RS03080 (FOB77_03080) | comGF | 557456..557917 (-) | 462 | WP_001874060.1 | competence type IV pilus minor pilin ComGF | - |
| FOB77_RS03085 (FOB77_03085) | comGE | 557871..558170 (-) | 300 | WP_001867089.1 | competence type IV pilus minor pilin ComGE | - |
| FOB77_RS03090 (FOB77_03090) | comYD | 558142..558570 (-) | 429 | WP_000793381.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16493.15 Da Isoelectric Point: 10.0345
>NTDB_id=387668 FOB77_RS03090 WP_000793381.1 558142..558570(-) (comYD) [Streptococcus agalactiae strain FDAARGOS_669]
MKNLLLKCKDKKVKAFTLLESLIVLSVVAFMTLVFSTSFNNIFRQVEETIFFISFEHLYRDTQKLSAFGQKKQTLTISHN
YLENTYERLYLPKTVKVVKSDTLAFDANGGNSSLAKIQFECYRKTVTYQLYIGSGNYRKKEN
MKNLLLKCKDKKVKAFTLLESLIVLSVVAFMTLVFSTSFNNIFRQVEETIFFISFEHLYRDTQKLSAFGQKKQTLTISHN
YLENTYERLYLPKTVKVVKSDTLAFDANGGNSSLAKIQFECYRKTVTYQLYIGSGNYRKKEN
Nucleotide
Download Length: 429 bp
>NTDB_id=387668 FOB77_RS03090 WP_000793381.1 558142..558570(-) (comYD) [Streptococcus agalactiae strain FDAARGOS_669]
ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAGAGCCTTATTGTATTATCAGT
AGTGGCATTTATGACGTTAGTATTTTCAACATCATTTAATAATATTTTTAGGCAGGTTGAAGAAACAATTTTCTTCATAT
CCTTTGAACATCTTTATAGAGATACTCAGAAATTGAGTGCATTTGGTCAGAAGAAACAAACCCTTACAATCTCTCATAAT
TATCTCGAAAATACTTATGAGAGACTTTATTTACCTAAAACTGTAAAAGTAGTCAAAAGTGACACACTTGCATTTGACGC
TAATGGAGGGAATTCAAGCTTGGCAAAAATTCAATTTGAATGTTATAGAAAAACTGTTACGTATCAATTATATATAGGAA
GTGGTAATTATCGTAAGAAAGAAAATTAG
ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAGAGCCTTATTGTATTATCAGT
AGTGGCATTTATGACGTTAGTATTTTCAACATCATTTAATAATATTTTTAGGCAGGTTGAAGAAACAATTTTCTTCATAT
CCTTTGAACATCTTTATAGAGATACTCAGAAATTGAGTGCATTTGGTCAGAAGAAACAAACCCTTACAATCTCTCATAAT
TATCTCGAAAATACTTATGAGAGACTTTATTTACCTAAAACTGTAAAAGTAGTCAAAAGTGACACACTTGCATTTGACGC
TAATGGAGGGAATTCAAGCTTGGCAAAAATTCAATTTGAATGTTATAGAAAAACTGTTACGTATCAATTATATATAGGAA
GTGGTAATTATCGTAAGAAAGAAAATTAG
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYD | Streptococcus mutans UA140 |
52.273 |
92.958 |
0.486 |
| comYD | Streptococcus mutans UA159 |
52.273 |
92.958 |
0.486 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
43.662 |
100 |
0.437 |
| comGD/cglD | Streptococcus mitis NCTC 12261 |
41.045 |
94.366 |
0.387 |
| comGD/cglD | Streptococcus pneumoniae TIGR4 |
43.307 |
89.437 |
0.387 |
| comGD/cglD | Streptococcus mitis SK321 |
43.307 |
89.437 |
0.387 |
| comGD/cglD | Streptococcus pneumoniae Rx1 |
42.52 |
89.437 |
0.38 |
| comGD/cglD | Streptococcus pneumoniae D39 |
42.52 |
89.437 |
0.38 |
| comGD/cglD | Streptococcus pneumoniae R6 |
42.52 |
89.437 |
0.38 |