Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   FGF55_RS12360 Genome accession   NZ_CP041691
Coordinates   2530455..2530832 (-) Length   125 a.a.
NCBI ID   WP_014418373.1    Uniprot ID   I2C7P9
Organism   Bacillus amyloliquefaciens strain ZJU1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2525455..2535832
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGF55_RS12320 (FGF55_12320) - 2525952..2526746 (+) 795 WP_014418368.1 YqhG family protein -
  FGF55_RS12325 (FGF55_12325) sinI 2526923..2527096 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  FGF55_RS12330 (FGF55_12330) sinR 2527130..2527465 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  FGF55_RS12335 (FGF55_12335) tasA 2527513..2528298 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  FGF55_RS12340 (FGF55_12340) sipW 2528363..2528947 (-) 585 WP_014418370.1 signal peptidase I SipW -
  FGF55_RS12345 (FGF55_12345) tapA 2528919..2529590 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  FGF55_RS12350 (FGF55_12350) - 2529849..2530178 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  FGF55_RS12355 (FGF55_12355) - 2530219..2530398 (-) 180 WP_003153093.1 YqzE family protein -
  FGF55_RS12360 (FGF55_12360) comGG 2530455..2530832 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  FGF55_RS12365 (FGF55_12365) comGF 2530833..2531228 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  FGF55_RS12370 (FGF55_12370) comGE 2531242..2531556 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  FGF55_RS12375 (FGF55_12375) comGD 2531540..2531977 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  FGF55_RS12380 (FGF55_12380) comGC 2531967..2532275 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  FGF55_RS12385 (FGF55_12385) comGB 2532280..2533317 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  FGF55_RS12390 (FGF55_12390) comGA 2533304..2534374 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  FGF55_RS12395 (FGF55_12395) - 2534567..2535517 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14119.10 Da        Isoelectric Point: 9.9337

>NTDB_id=373114 FGF55_RS12360 WP_014418373.1 2530455..2530832(-) (comGG) [Bacillus amyloliquefaciens strain ZJU1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVKVTIQAETMTGTRREATLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=373114 FGF55_RS12360 WP_014418373.1 2530455..2530832(-) (comGG) [Bacillus amyloliquefaciens strain ZJU1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGCCGGGAAACGGTTAAGGTTACAATTCAGGCGGAAACCATGACAGGCACGAGACGGGA
GGCTACCCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment