Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | FGF55_RS12325 | Genome accession | NZ_CP041691 |
| Coordinates | 2526923..2527096 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus amyloliquefaciens strain ZJU1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2521923..2532096
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGF55_RS12310 (FGF55_12310) | gcvT | 2522736..2523836 (-) | 1101 | WP_014418366.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| FGF55_RS12315 (FGF55_12315) | - | 2524260..2525930 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| FGF55_RS12320 (FGF55_12320) | - | 2525952..2526746 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| FGF55_RS12325 (FGF55_12325) | sinI | 2526923..2527096 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| FGF55_RS12330 (FGF55_12330) | sinR | 2527130..2527465 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| FGF55_RS12335 (FGF55_12335) | tasA | 2527513..2528298 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| FGF55_RS12340 (FGF55_12340) | sipW | 2528363..2528947 (-) | 585 | WP_014418370.1 | signal peptidase I SipW | - |
| FGF55_RS12345 (FGF55_12345) | tapA | 2528919..2529590 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| FGF55_RS12350 (FGF55_12350) | - | 2529849..2530178 (+) | 330 | WP_014418372.1 | DUF3889 domain-containing protein | - |
| FGF55_RS12355 (FGF55_12355) | - | 2530219..2530398 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| FGF55_RS12360 (FGF55_12360) | comGG | 2530455..2530832 (-) | 378 | WP_014418373.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| FGF55_RS12365 (FGF55_12365) | comGF | 2530833..2531228 (-) | 396 | WP_014721501.1 | competence type IV pilus minor pilin ComGF | - |
| FGF55_RS12370 (FGF55_12370) | comGE | 2531242..2531556 (-) | 315 | WP_032863566.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| FGF55_RS12375 (FGF55_12375) | comGD | 2531540..2531977 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=373112 FGF55_RS12325 WP_014418369.1 2526923..2527096(+) (sinI) [Bacillus amyloliquefaciens strain ZJU1]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=373112 FGF55_RS12325 WP_014418369.1 2526923..2527096(+) (sinI) [Bacillus amyloliquefaciens strain ZJU1]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |